KEGG   Geobacter uraniireducens: Gura_3250Help
Entry
Gura_3250         CDS       T00521                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gur  Geobacter uraniireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gur00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3820427..3821926)
Genome map
AA seq 499 aa AA seqDB search
MQHRRKSGVLLHPTSLPGSGGIGSFGSDARRFIDFLHKSGQTIWQILPLGPTAYGNSPYS
CYSAFAGNPLLVSLETIVDEGDVPGKELKIDLPEERVDYHAVERHKYHVLRKAAASFFTA
GEQCRKEDFWRFCDSTFWLHDYALFMALKEHFKGKSWCDWPEDIALRKPEALEEYSQKLG
AAIGEQKYMQWQFSRQWLRLKSYANEMGIEIIGDMPIFVAFDSVDVWANPHLFHLNDEGR
PTVVAGVPPDYFSKTGQLWGNPLYNWDKVASDGFGWWVARLRNDLSLYDMVRIDHFRGFE
AYWEVPAREKTAKNGRWVKGPGESLFHALIDQLGQLPLIAEDLGVITPEVEALRDRFGFP
GMKILQFAFGSGPKNPYLPHNHTRNCAVYTGTHDNDTTSGWFASLKEKDQQNILDYLNVS
GENISWELIRAALASVADIAVFPLQDILELPSTGRMNIPGVAGGNWSWRFTADALNSSVA
KRLKELTKLYGRGKGNHWN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacagaagaaaaagcggtgtcctgctccaccccacatctctgccgggttccggg
gggattggctcatttgggagcgatgcgcgccgtttcattgatttccttcacaagtccggt
caaacgatctggcagatattgcctttagggccaacggcttatggtaactctccatactcc
tgctattcggcttttgccggcaatcccctgcttgtttcacttgaaactattgttgacgaa
ggggatgtcccaggcaaggagttaaagattgatttgccggaagagcgcgttgattatcac
gcggttgaacggcataaatatcatgtgttgcgcaaggcggcagcatcttttttcactgcg
ggcgagcaatgccgtaaggaagatttctggcgcttctgtgacagcactttctggcttcac
gactatgccctctttatggcgctcaaggaacatttcaaggggaagagctggtgcgactgg
ccggaagatattgccctgcgcaaaccggaagccctggaagaatattcgcaaaagctcgga
gccgccatcggtgaacagaaatatatgcagtggcagttttctcgccaatggctgcgctta
aagtcgtatgcaaatgaaatgggaatagaaataatcggtgacatgcctatatttgtagcc
tttgattcggtggatgtctgggccaatccacacctgtttcacctgaacgatgaggggaga
ccgactgtcgtggccggtgtgccacccgattatttcagtaaaaccggtcaattgtggggt
aatccgctctataattgggataaggtcgcgtctgacggctttggctggtgggtggcccgt
ttgcgtaacgatctctccctctatgatatggtcaggatagaccattttcgcggtttcgag
gcgtactgggaggtgccggctagggaaaagacagcaaaaaacggccgatgggttaaaggt
cccggcgaatctctctttcatgccttgatcgaccaacttggtcaattgcctcttatagca
gaggacctgggggtaataacgccagaggttgaagctttgcgggacaggtttggctttccg
ggcatgaagatcctccagtttgctttcggctccggtcccaagaatccctatcttccccat
aatcatacaaggaattgcgcagtttataccggaacccatgacaacgatactacctcaggg
tggtttgcctccctcaaggaaaaagatcagcaaaatatcctcgattatcttaatgtcagc
ggggaaaatatcagttgggagctgatccgggcagcactggcgtcggtggcggatattgcc
gtctttccacttcaggatatcctggagcttccaagtacgggacggatgaatatcccgggt
gttgccggaggcaactggtcatggcggtttactgccgacgcactcaacagcagcgtagcg
aaacgcctgaaggagctgactaaattgtatgggcggggaaagggtaaccactggaattaa

DBGET integrated database retrieval system