KEGG   Geobacter uraniireducens: Gura_3269Help
Entry
Gura_3269         CDS       T00521                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gur  Geobacter uraniireducens
Pathway
gur00030  Pentose phosphate pathway
gur01100  Metabolic pathways
gur01120  Microbial metabolism in diverse environments
gur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gura_3269
Enzymes [BR:gur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Gura_3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABQ27428
UniProt: A5G6L0
Position
complement(3839354..3841093)
Genome map
AA seq 579 aa AA seqDB search
MHGWTGKILKVDLASGKAWREDVPFELLHAYLGGRGLGVRLMRDYFMLDPFAPEMPLIFA
VGPLCGTVAPTAARLTVVSRSPLTGTIYDCSAGGRFAWRLKAAGVDALFLTGQSAKPVVL
AINGDDAELLPAGELWGKAVPDTVSALSGGGSVACIGPAGENGVLYANIMMGEGNSVGRG
GLGAVMGRKKLKAVIVDGDRATAVADQSRFDHARQDVMRLFRASPVIFGELGIAEYGTPA
LVDLMRQRRMAPTENFRKTVFPDSGNYSGPAIRKACEAKKDGCFGCPIQCKKSTPQGEPL
PEYETVSHFGALNGIADLHAIVKANTLCNELGLDTITAAATLAAWGEAKGRFPAAEEVAP
LLADIAHRRGEGELLSLGSRRVAEALGVPNLSMSVKSLELPAYDPRGAYGMALAYCTSNR
GGCHLRAYPISHEILRKPVPTDRFSFSGKARIIKIAEDTNAAVDSLVACKFSFFGATIEE
YAELLSATSGIEYSPQSLKEIGGRIYLTERFYNCANGFTFADDLLPERFYNEPGSSGEGI
EIHPIDRQRFNEELQKYYRIRRLTPEGTFADPGFLSNQP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttggaccggaaaaatactgaaggttgacttggcgagcggcaaggcatggcgg
gaggatgtacctttcgaactgctccatgcctatctcggtgggcgtgggctgggggtgcgg
ctgatgcgggattatttcatgcttgacccgttcgccccggagatgccgctgatctttgcc
gtcggccctttgtgcggcaccgttgcccccactgctgcccggctgacggtggtttcccgc
tcgccactgaccggcaccatttacgactgttccgccggggggcggtttgcctggcgcctc
aaggcagccggggtggatgccctgttcttaaccggacagagcgcgaagcccgtggtgctc
gccatcaacggtgatgatgcggaacttttgccggccggggagctgtggggcaaagctgtc
cctgataccgtctccgccctgtccggaggggggagcgtcgcctgtatcggccctgccggg
gagaacggtgtcctctacgccaatatcatgatgggggaggggaactccgtcggccgtggc
ggtctcggcgctgtgatgggaaggaaaaagctcaaggcagtgatcgttgacggcgaccgg
gccaccgctgttgccgaccagagccgctttgaccatgcccgccaggatgtgatgcggctg
ttccgcgcctcgccggtcatttttggcgaattggggatagccgaatacggtacgccggca
ctggtggacctgatgcgccagcggcgcatggccccgaccgaaaacttcagaaagacggtg
tttcccgattccggcaactattccggcccggcaatccgcaaagcgtgcgaagcgaaaaaa
gacggctgttttggctgccccatccagtgcaagaagagcaccccccagggggagccgctt
cccgaatacgaaaccgtttcccacttcggcgccttgaacggcatcgcagacctgcatgcc
atagtcaaggccaataccctctgcaacgagctggggctcgacactattaccgccgcggcc
acccttgccgcctggggcgaggcaaaggggcgctttcccgctgcggaggaggtcgcgcca
ctccttgccgacatagcccatcgccgcggggagggggaactgctctccctcggctcacga
cgggtcgccgaggccttgggcgtgccgaacctttccatgagcgtcaagtcgttggaactc
cctgcctatgatccccgcggggcatacggcatggccctcgcttactgcaccagcaaccgt
ggcggctgccacctgcgggcctatcccatctcccacgagatcctgcgcaagccggttccc
accgaccgcttttcattttcaggcaaggcgcgcatcatcaagatcgccgaggacaccaac
gctgccgtagattccctggtggcctgcaaattctcctttttcggcgcgaccatcgaggaa
tacgccgaactcctttccgccacgagcggcattgaatactccccccagtcgctcaaggag
atcggcgggcggatttacctgaccgaacgtttttacaactgcgccaacgggttcaccttc
gcagacgacctgctgccggaacggttttacaacgagcccggctccagcggcgaggggatc
gaaatccacccaatcgatcggcaacgctttaacgaagagttgcagaagtactaccggatt
cgcaggctgacaccggaaggaacttttgccgatcctggtttcctctctaatcagccgtaa

DBGET integrated database retrieval system