KEGG   Geobacter uraniireducens: Gura_3288Help
Entry
Gura_3288         CDS       T00521                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gur  Geobacter uraniireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gura_3288
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gura_3288
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gura_3288
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gura_3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3863379..3864572)
Genome map
AA seq 397 aa AA seqDB search
MKLPDKQGHFGQFGGRYVSETLMPALFELEKAYNHYKNDKEFKEEFAYYMRQYVGRPNPL
YFAEKLSKKLGGAKIYLKREDLNHTGAHKVNNTIGQGLLAKRMGKKRVIAETGAGQHGVA
TATIAALFDMECEVFMGEEDIHRQSLNVFRMKLLGAKVTPVTAGTATLKDAMNEALRNWV
THVGNTFYVIGTVAGPHPYPLMVRDFQSIIGREAKAQHKKIEGRLPDYLVAAVGGGSNAL
GLFHPFMNDKDVKMVGVEAAGYGISSGKHAAPLCAGSVGVLHGNKTYLLQDEFGQIAHAH
SISAGLDYPGVGPEHAWLKESGRADYVSVTDEEALEGFRVLTREEGILPALESSHAIAHV
LKMAPTLSKDKTIIVCLSGRGDKDIHTVAEAMGVKLE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattacccgataagcaagggcatttcggccagttcggcggcagatacgtatcggaa
acattgatgccggcgctgttcgagctggagaaggcttacaaccattacaaaaacgataaa
gagttcaaggaagaatttgcctattatatgcgccagtatgtggggcgacccaatcccctc
tactttgcggaaaaactcagcaaaaagctcggcggggcaaagatttacctgaaacgtgaa
gacctgaatcataccggtgcccacaaggtgaacaacaccatcggccagggactcctggcc
aagcggatgggtaaaaaacgggtgatagccgaaaccggcgccggtcagcacggtgttgcc
acagccaccattgccgctcttttcgacatggagtgcgaggtgttcatgggcgaggaggat
atccaccggcagtcgctgaacgtttttcgaatgaaactcctcggtgccaaggttactccc
gtgacagcgggcaccgccaccctcaaggacgccatgaacgaggcgctgcgcaactgggta
acccatgtcggcaacacgttctatgtcatcggcaccgtcgccggtccacatccttatccc
ctgatggttcgcgatttccagtcgattatcggccgggaggcaaaggcgcagcacaaaaaa
atcgaggggcggcttcctgattatctggtggctgccgtaggcggcgggagcaacgccctc
ggtctcttccacccattcatgaatgataaggacgtgaaaatggtcggggtcgaggcggcc
ggttatggaatctcctccggtaagcacgcagcgcctctctgtgccgggagcgtcggagtg
cttcacggcaacaagacctatctgcttcaggatgagttcggccagattgcccacgcccat
tccatttccgccggtctcgactatcccggcgtcggtcctgaacatgcatggctgaaggaa
tcaggccgtgccgattatgtatcggtaaccgatgaggaggcgctggaagggttcagggta
ttgacccgggaagaggggatactgccggcactggagtcatcccatgccattgcccatgtg
ctgaaaatggcgccgactctctctaaggacaagacaatcattgtctgtctctccggccgg
ggggacaaggatattcatacggttgccgaggcaatgggggtaaagctggaatag

DBGET integrated database retrieval system