KEGG   Geobacter uraniireducens: Gura_4057Help
Entry
Gura_4057         CDS       T00521                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
gur  Geobacter uraniireducens
Pathway
gur00340  Histidine metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Gura_4057
Enzymes [BR:gur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Gura_4057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABQ28201
UniProt: A5G8T3
Position
complement(4714664..4715953)
Genome map
AA seq 429 aa AA seqDB search
MQFLDIHDNNFEANFAAILARGEETGKEVEQVVLDIIAAVRKEGDAALLDYTRRFDRLEA
DTVADLEVTEAEFNEAFVRVADADISALKLAVERVARFHEKQKQETWLSTDESDVLLGQM
VTPLERVGIYVPGGKASYPSSVIMNAVPAKVAGVGEVVMVAPTPGGEINHHVLVAARLSG
VDRVFRIGGAQAVAALAYGTAMVPRVDKITGPGNIYVATAKKLVFGQVGIDMIAGPSEIL
VINDGSGNPAHIAADLLSQAEHDELASSILITTSRSFGERVAAEVELQLGKLKRESIARK
SWDTYGAVIVAGSIAEAIAFSNRIAPEHLELAVTDPFAILPQIRNAGAIFLGHFTPEAAG
DYLAGPNHTLPTGGTARFFSPLSVDDFIKKSSIVYFSESGLNRLGKDIVRIAELEGLEAH
GKSVSIRLK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttctcgacatccacgacaataactttgaggcgaactttgccgccatcctggca
cggggcgaggagaccggcaaggaggtcgagcaggttgttctcgacatcattgctgccgtt
cgcaaggagggtgatgcagcgctgctcgactacacacggcgcttcgaccggctggaggcc
gataccgttgccgatttggaagtgaccgaggcggagttcaacgaggcctttgtccgggtg
gcggatgccgacatttcggcactcaagctggcggtggagcgggtggcccgcttccacgaa
aagcagaagcaggaaacctggctttccaccgacgaaagcgatgtcctgctcggccagatg
gtgacgccgctcgaacgggtcggtatttatgttccgggcggtaaggccagttatccttcg
agcgtcatcatgaacgcggtgccggccaaggtggctggtgtaggcgaggtggtcatggtt
gccccgaccccggggggagagataaatcatcacgtgcttgtggctgcacgactctccggc
gtggatcgggtttttcgcatcggcggagcccaagccgttgcggcgctggcttacggtacg
gcgatggtgccgagggtggacaagatcaccggcccgggcaatatctatgtggccacagcc
aagaagctggtgttcggccaggttggcattgacatgatcgccggtccttccgagatactc
gtcatcaacgacggcagcggcaatccggcgcacatcgccgccgatctcctttcccaggcc
gagcacgacgaacttgcctcgtccatcctcatcaccacgagccgctccttcggtgaacgg
gtggccgcggaagttgaacttcagctcgggaagctcaagcgcgagagcatcgcccgcaaa
tcgtgggatacttacggtgcggtcatcgttgccggcagcattgccgaggctattgcattt
tccaaccggatcgccccggagcatctggagctggcggtgacagacccgtttgccattctg
ccgcagatacgcaatgccggcgccatttttctcggccacttcacgcccgaggcggccgga
gactacctggccggccccaaccataccctgccgaccggcggcaccgcccgattcttctct
cccttgtcggtggacgatttcatcaagaaatcctccatcgtctatttcagcgaaagtgga
ctcaatcggctgggcaaagacatcgtacggatcgccgaactggaagggttggaagcccac
ggcaagtcggtcagcatacgattgaaataa

DBGET integrated database retrieval system