KEGG   Geobacter uraniireducens: Gura_4349Help
Entry
Gura_4349         CDS       T00521                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gur  Geobacter uraniireducens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gura_4349
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gura_4349
   00640 Propanoate metabolism
    Gura_4349
   00660 C5-Branched dibasic acid metabolism
    Gura_4349
Enzymes [BR:gur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gura_4349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5036688..5037851)
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKGILRSFGVPVPDGHVCYNGASAREWAKRLGEGPWVVKAQIHAGGRGKGGGV
KLARTPDEVGNIARDMLGMILSTHQTGPEGKVVTRVLVENGCIIARELYVSLLVDRSSSK
VTVMASTEGGMDIEEVAAKTPEKIYMEAVDPLVGLTQFQCRKLAFSLGLEGKLVVKAVKM
FEGLYTTFIACDCSLLEINPLVVTADSELLALDAKFGFDDNAVFRHPKIADLRDYDEEDP
NEVEASQHDLSYISLSGNIGCLVNGAGLAMATMDIIKHYGGDPANFLDVGGGATIERVTE
AFKIILSDRNVKGILVNIFGGIMKCDVIATGVIEAAKQVGIKVPLVVRLEGTNVKKGTQL
LAESGLDIVAADGMADAARKIVKAVAA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgagtatcaggcaaaagggatattaaggagcttcggcgtgcccgtaccc
gatgggcatgtctgttacaacggggccagtgcccgcgagtgggccaagcgcctcggcgaa
ggcccatgggtcgtcaaggcccagatccacgccggcggccgcggcaagggtggcggggtc
aaactggcccgcacccccgacgaagtaggcaacatcgcccgcgacatgctcggtatgatc
ctctctacccaccagaccggccccgaagggaaagtcgttacccgcgtcctcgtcgagaac
ggctgcatcattgctcgtgaactctacgtcagcctcctcgtcgaccggagcagttcaaag
gtaactgtcatggcatctaccgaaggtgggatggatatcgaagaggttgcagcaaagacc
ccagaaaagatctacatggaggcggtagatcccctcgtcggtctcacccagttccagtgc
cgcaaactcgccttcagccttggcctggaaggtaagcttgtggtgaaggccgtcaaaatg
ttcgaagggctctacaccaccttcatcgcctgtgattgctctctgttggaaatcaacccc
cttgttgtcaccgctgatagcgaactcctcgctctcgacgccaaattcggcttcgacgac
aacgccgtcttccgccatcccaagatcgccgacttaagggactacgacgaagaagacccc
aacgaagtcgaagcctcccagcacgacctctcctacatctcccttagcggcaacatcggc
tgtctcgtgaacggcgccggcctcgccatggccaccatggacatcatcaagcactacggc
ggcgaccccgctaactttctcgatgtcggcggcggtgccaccattgaaagggttaccgaa
gccttcaagatcatcctctccgaccgaaacgtcaaggggatcctcgtcaacatcttcggc
ggcatcatgaaatgcgacgtgatcgccaccggggtcatcgaggcggcaaaacaggtcggc
atcaaggtgccgctggtggtgcgcctggaaggaaccaacgtgaagaaggggacgcagctc
cttgccgaaagcggactcgacatcgtcgccgccgacggcatggccgatgccgcccggaaa
atcgtcaaggccgtagctgcctga

DBGET integrated database retrieval system