KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0127Help
Entry
HMPREF0424_0127   CDS       T01146                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0424_0127 (recR)
DNA repair and recombination proteins [BR:gva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HMPREF0424_0127 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147491..148099
Genome map
AA seq 202 aa AA seqDB search
MHNSSSYDGAIGRLIEAFSKLPGIGPKGAQRIAFYLLSSSDKDVQELIDAINNMKESVRF
CDVCGNVCEQSPCIVCADPRRDHSKICVVEEPKDIMSIERTHEYSGVYHVLGGAINPMAN
VGPGDLAITQLLERLKDAKVQEIILALDPDIEGEATVTYLARLLDPLGIKVTRLASGLPV
GGDLEYADEITLGRAFSGRQSV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcataattcatcgtcatatgatggagcaattggtcgcttaattgaagcattttcaaag
cttccagggattggacctaaaggcgctcagcgtattgcgttttacttactttcttcctcg
gataaagatgttcaagagctaatagacgcaattaataacatgaaagaaagtgtgcgtttt
tgtgatgtatgcggaaacgtatgtgagcagagtccttgcatagtatgcgcagatcctcgg
cgtgatcatagcaaaatttgcgtagttgaagaacctaaagacattatgagtattgagcga
actcatgagtattcaggtgtttatcatgttcttggtggtgcaattaacccaatggcaaat
gttgggcctggggacttagcaattacgcaattacttgaacgtcttaaagatgcaaaagtt
caagaaattattcttgcgcttgatcctgatatagaaggtgaagcgactgttacgtatttg
gctcgattgctcgatcctctaggaattaaagttactcgcttggcaagtggattgcctgtt
ggtggagatttagagtatgcggatgagatcactttaggtcgtgcattttctggccgtcaa
tctgtgtaa

DBGET integrated database retrieval system