KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0251Help
Entry
HMPREF0424_0251   CDS       T01146                                 

Gene name
malQ_1
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0424_0251 (malQ_1)
Enzymes [BR:gva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF0424_0251 (malQ_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276717..278882
Genome map
AA seq 721 aa AA seqDB search
MDNTTDEEVAMKPLHRLAELMGVGVSFIGSDNQKHEIQDNVLVSVLSALGVDASTNETIE
KSTNDVLAYRHGRIVAPTVLHTVGKCDEVTVNTGILEYPVATLTLENGEQYKGDLTIVPN
ENDVAYPVNGKFVATSLIKIPEDVPMGYHTLRVTVGERQEEATLISAPESIDTLNSLEPN
GEQLWGWMAQLYSIRSSKSWGVGDFADLATLLTEAKQKTGADFVLINPMHAGEPITPLTP
SPYLPVARGMVNVTYISPESIPEYETLNDKTRKEIEKLHGQVEPLNNDAQIIDRDSMWRV
KMRALWLIFKAGMSEDRARIFNEFKHEMGDRLESYATWCLCYDKWGAPKGDDCWEKTLTK
DSDQVRELANRFPDTLEFYRWLEWVAFTQLHDAQVAARKAGMKIGIMSDMAVGVHPAGSE
VWWNPERFANGATVGAPPDYFNQQGQDWSQPPLHPFELERTGFKTYRDMVHGMFASAGAV
RIDHILGLFRLWWIPEGSAPSGGAYVYYDADIMLGILAIEAARAHGVVVGEDLGVLPANA
LEVLRKKAVLGCTVEWFEERDGEFRTPDKWREMTLASVNTHDLPPAAGYLRYEQVNIRER
LHLLTGSVEEFRAGAEAEHRAMMRMLVKGGYLDAQLLEDEDAHTQEIVEALYRALKAAPS
RLLAASLVDAVGECRVQNQPGTNDEYPNWRIPLADGEGNPVSLDNMFDLPRVQSLSAIMN
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggataatacaacagatgaagaagtagcaatgaagccattacaccgtcttgctgaatta
atgggcgttggcgtgagttttattggttcggataatcaaaaacacgagattcaagataac
gtattagtttctgtcttaagcgcattaggcgtagatgcttccacaaatgagacaatagaa
aaatctacaaacgacgttttagcgtatcgacacggtcgtattgttgctccaacagttttg
cacactgttggcaaatgtgatgaagttacagttaatacgggaatattagaatacccagtt
gcaacattgacattggaaaatggtgaacaatataaaggcgatttaactattgttcctaac
gaaaatgatgttgcataccctgtaaatggaaaatttgttgcaacatctcttataaaaatt
cctgaagatgtgccaatgggttatcacacattgcgtgtgacagttggtgagagacaagaa
gaagcaacacttattagtgctccagaaagcattgatacgctgaattccttagagcccaat
ggagaacagctttggggatggatggcacaactttactcaatccgttcttcaaagtcttgg
ggtgttggtgattttgctgatttggcgactcttcttactgaagctaagcaaaaaactggc
gctgactttgtgttaataaacccaatgcatgcaggtgagcctataactccgcttactcca
tccccatacctgccggttgctcgaggaatggtaaacgtaacgtatattagcccagaaagt
attcctgagtacgaaacgttaaacgataaaactcgcaaagaaattgaaaagcttcatgga
caggttgagccgcttaacaatgacgcgcaaataatagaccgtgattccatgtggcgtgta
aaaatgcgtgcattgtggctgattttcaaggctggtatgtctgaagatcgcgctcgcatt
tttaatgagtttaagcatgagatgggtgacaggcttgaatcttatgccacttggtgcttg
tgctacgacaagtggggtgctccaaagggtgacgattgctgggagaaaactcttactaag
gattctgatcaagttcgcgaattagctaatcgtttcccagatactcttgagttttatcgt
tggcttgagtgggttgcttttacgcaattgcatgatgctcaagttgctgcacgtaaagct
ggtatgaaaatcggcattatgtctgatatggctgttggcgtgcatcctgcaggatctgaa
gtttggtggaatccggagagatttgctaacggagctactgttggcgctccacctgattac
ttcaatcagcaaggtcaagattggtctcagccacctttgcacccatttgagcttgagcgg
actggttttaaaacataccgagatatggttcatggaatgtttgcttcggcaggtgctgtt
cgcattgaccatattcttggacttttccgcttatggtggattccagaaggttcagctcca
agtggcggtgcttatgtttactacgatgctgatattatgcttggcattttggcaattgaa
gccgctcgtgctcacggtgtagttgttggcgaagatttgggtgttttgcccgcaaatgct
ttggaagtgttgcgcaagaaggctgtgcttggttgcacggttgaatggttcgaagagcgt
gacggcgaattccgtactccagacaagtggcgcgaaatgacgcttgcatctgtaaatacg
catgatttgcctcctgctgccggctatttgcgctatgagcaagttaatattcgtgagcgc
ttgcacttgcttactggttctgttgaagaattccgcgctggagctgaggcagagcatcgc
gctatgatgcgaatgttggtcaaaggtggttatttggatgctcagttgcttgaggatgag
gatgctcatactcaggagattgttgaagcattgtaccgcgctttgaaggctgctccttcc
agattgttggctgcttctttggtcgatgcagttggagagtgtcgtgtgcaaaatcagcct
ggaacgaatgacgagtatccgaattggcgtattccattagctgatggtgaaggcaatcct
gtgtccttggataatatgtttgatttgcctcgagtgcagtcgctttctgcgattatgaat
gcataa

DBGET integrated database retrieval system