KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0254Help
Entry
HMPREF0424_0254   CDS       T01146                                 

Gene name
adh
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0424_0254 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0254 (adh)
   00620 Pyruvate metabolism
    HMPREF0424_0254 (adh)
   00650 Butanoate metabolism
    HMPREF0424_0254 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0424_0254 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0424_0254 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0424_0254 (adh)
   00626 Naphthalene degradation
    HMPREF0424_0254 (adh)
Enzymes [BR:gva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0424_0254 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0424_0254 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280455..283160
Genome map
AA seq 901 aa AA seqDB search
MVEAQHQAETGKTASADDIALAAQNEVDKLVEKATVALNEFEKLNQQQIDHIVAKASVAA
LNKHLVLAKMAVDETGRGLVEDKATKNIFACEHITHYLAGQKTVGIIREDDVLGIDEIAE
PVGIVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPFAQKCSSEAARIVRDAAVAAGA
PKDCIQWIEHPSIEATGALMKHPKIATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVD
SDVDIVRAANDLILSKHFDYGMICATEQAIIAHKDVYEPLLRELKHRKAYFVNADEKAKL
EQYMFGCTAYSGNTPKLNSLVPGKSPQYIAHEAGFEIPEDAVILVAECKEVGEMEPLTME
KLAPVHAMLRAENKEQGFKMCEQMLVHGAGHTAVIHTNNQDLVREYGVRMHACRIVWNSP
GSLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAINLLNIKRIARRNNNMQWFKIPAKT
YFEPNAIRYLRDMYGVERAVIVCDKVMEQLGVVDKIVDQLRARDNRVSFRIIDYVEPEPS
VETVERGAAMMRDEFQPDTIIAVGGGSPMDASKIMWLMYEHPEISFADLREKFFDIRKRA
FKIPPLGSKAKLICIPTSSGTGSEVTPYAVITDHKTGYKYPITDYALTPTVAIVDPVLAR
TQPRRLACDSGFDALTHAMEAYVSVYANDFTDAMALHASKLIWENLNDSVNCEDSQRKIE
AKEKMHNAATMAGMAFGSAFLGMCHAMAHTIGALCHVVHGHTNAILLPYVIRYNGQIPQE
PTSWPKYNRYIALERYQEIAKNLGVDPGKTPEEGVENLARAVEEYRNEKLGMDASFKACG
VDEAYYWSILDNIGMRAYEDQCAPANPRIPQIEDMKDIAIAAYYGVSQEEGHRMRLEREA
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggcacaacaccaagccgaaactggcaaaactgctagtgctgatgacattgcg
ttagctgctcaaaatgaagttgataaacttgttgaaaaagcaactgtcgctttgaatgag
tttgagaagcttaatcagcagcaaattgatcatattgttgctaaagcttcagtggcagcg
ttgaataaacatttggttcttgcaaagatggctgttgatgaaacaggtcgtggtttagta
gaagataaagctacaaaaaatatctttgcatgcgaacatattacgcattatctagcaggt
caaaaaacagttggtattattcgcgaggacgatgttctcggaattgacgaaatagctgaa
ccggttggtattgttgcaggcgtcactccagttacaaacccaacttctacagctattttt
aagtcgcttattgcacttaagactcgttgcccaattatttttggattccatcctttcgcg
caaaagtgctcttctgaagcagctcgaattgttcgcgatgctgctgtggctgcaggcgcg
ccaaaagattgcattcagtggattgagcatccttcaattgaagctactggtgcattgatg
aaacatccaaagatcgcaactattcttgcaacaggcggtcctggaatggttaaggcggcg
tattcttcaggaaaacctgctcttggtgttggtgctggaaatgctcctgcatatgtcgat
agtgatgttgatattgtgcgtgctgcaaacgatttgattctttcaaagcattttgattac
ggaatgatttgtgcaacagagcaagcaattattgcgcataaggatgtatatgagccattg
cttcgcgaattgaagcacaggaaagcatattttgttaacgctgacgaaaaagctaagctt
gaacaatatatgtttggatgcactgcatattctggaaatacgccaaaacttaattctctt
gttcctggtaagtctccgcaatatattgcgcacgaagctggatttgaaattccagaagat
gctgtgattttggttgcagagtgcaaagaagttggcgaaatggagccgcttactatggaa
aagctcgctcctgtacacgcaatgcttcgcgcagaaaataaggaacaaggcttcaagatg
tgtgaacagatgcttgtgcatggagctggtcacactgctgtaattcacacaaataatcaa
gatcttgtgcgcgaatatggtgttcgtatgcatgcttgcagaattgtttggaattctcct
ggatctcttggtggcgttggagacatttacaacgcgattgctccttcgcttactcttgga
tgcggatcttatggtggaaattccgtttctggcaacgtacaagctataaatcttcttaat
attaagcgtattgcacgaaggaataataatatgcaatggttcaagattccggctaaaact
tattttgagccgaatgctattcgttatttgagggatatgtatggcgttgagcgcgcagtt
attgtgtgcgataaggttatggagcaacttggcgtagtcgataagattgttgatcagctt
cgtgctcgagataatcgcgttagcttccgtattattgattacgttgagcctgagccaagc
gttgaaacagttgagcgtggcgccgcaatgatgcgtgacgaattccagccagacacaatt
attgctgttggtggcggttctccaatggatgcttctaagattatgtggcttatgtatgag
catccggagatttctttcgctgatttgcgagaaaagttcttcgatattcgtaagcgcgca
tttaagattccgcctcttggtagcaaagctaagcttatttgcataccaacttcttccgga
actggttctgaagttacgccttacgctgttattacagatcacaagactggatacaagtat
cctattacggattacgctttgactccaacggtcgcaatagtcgatcctgttttggctcgt
actcagccgcgtcgattggcgtgcgattctggttttgatgctttaactcatgctatggaa
gcttatgtttctgtttacgcaaatgattttacggatgctatggctttgcacgcttcgaaa
cttatttgggaaaatctcaacgattctgtgaattgtgaagattctcagcgcaagattgaa
gcaaaagaaaaaatgcataatgcagctactatggctggaatggcgtttggttctgcattc
ttaggaatgtgccacgctatggctcatactattggtgctttgtgccacgttgtacacggt
catacgaacgcaattttgctgccttacgttattcgctataacggtcaaattccgcaagag
ccaactagctggccaaagtacaaccgctatattgctcttgagaggtatcaggagatcgct
aagaatcttggtgtagatcctggtaaaactcctgaagaaggcgttgaaaatcttgctcgt
gctgttgaagagtatcgaaatgaaaagcttggcatggacgcttcgtttaaggcttgtggc
gtagacgaagcgtactactggtcgatacttgacaatattggcatgcgtgcttacgaagat
cagtgtgcgcctgcaaatcctcgtattccgcaaattgaggatatgaaggatattgctatt
gccgcatattatggtgtttctcaagaagaaggtcatcgcatgcgtttggagcgtgaagcg
gcgtaa

DBGET integrated database retrieval system