KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0820Help
Entry
HMPREF0424_0820   CDS       T01146                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0424_0820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0820
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0424_0820
Enzymes [BR:gva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     HMPREF0424_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(929353..930126)
Genome map
AA seq 257 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRYKILTPTVSTPQAVADIVRQQLEHFEV
PADVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QRFGAAKDKDGLVIATTLGTGIGTALIYNGVLIPNTELGHIQLEKGKGDAEKYAASSVRE
KLDMGYKKWAKRLTKYYGLMEKYFNPDLFVVGGGVSRVSEKFLPHIDIKTPIVVATLHNE
AGIIGAAYYAMQKMQQN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcatttggcgtcgatattggtggatccggtattaaggctgct
ccagtaaatttggaaaagggagagttcgcagaacctcgatacaaaattctcactcctacg
gtttctacgcctcaagcagttgcagatattgttcgtcagcagcttgaacattttgaagta
cctgcagatgttcctgttggaattgcattccctgctccaattaagcctggtaagaagctc
gattttatggcaaatcttgaccagtcttggattggtgttgatgttactgaagtctttagc
gaggcttgtggtcgtcctgtaacagtagttaacgatgccgatgctgctggtttagctgag
cagcgttttggtgcggcgaaagacaaggatggcttggttattgctactactcttggcact
ggtatcggcacggctttgatttacaacggtgtgcttattccaaacactgagcttggtcat
attcagcttgaaaaaggtaagggcgatgctgaaaagtacgctgcttcttctgttcgtgaa
aagttggatatgggctataagaagtgggctaagcgtttgactaagtactacggcctgatg
gaaaagtatttcaacccagatttgtttgttgtcggtggcggtgttagccgcgtaagcgaa
aagttcttgccgcatatcgatattaaaactcctattgttgttgcaacattgcataatgag
gctggaattattggtgcagcttactatgcaatgcaaaagatgcagcaaaactaa

DBGET integrated database retrieval system