KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0907Help
Entry
HMPREF0424_0907   CDS       T01146                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0424_0907 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF0424_0907 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0907 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0424_0907 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0424_0907 (tpiA)
Enzymes [BR:gva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0424_0907 (tpiA)
Exosome [BR:gva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0424_0907 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0424_0907 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0424_0907 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1034741..1035538)
Genome map
AA seq 265 aa AA seqDB search
MVVKRKPLVAGNWKMNFNHREATHFIQKFAWLLRDAHYDYHDCEIALMPSFTSIRSVQVL
VESDHLPILYGAQAVSVTAQGAFTGDVSADMLASLGCSMVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESLKERQQGVALDFAVGQVHDVTRDLDAKQAKRLIIAYEPVWA
IGTGMVATANSAQEAALAIREDLRVTFGDDVADTVRILYGGSVTSSNASSLIAEPDVDGF
LVGGASLDAEELSNIVRLTAAQSRL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttgttaaaagaaagccgctagtcgcaggtaattggaaaatgaacttcaatcaccgc
gaagcaacgcattttatacaaaaatttgcgtggctactgcgtgacgcgcattacgactat
cacgattgtgaaattgcacttatgccttcttttacttcaataagaagcgtgcaagttctt
gttgagtctgaccatttgccaatattgtacggagctcaagctgtttctgttactgctcaa
ggtgcttttactggtgatgtttctgcagatatgcttgcaagtcttggatgttcaatggtt
attgttggtcattctgaaagacgcaagtatcatcctgaagatgatgcaaatatagttgat
caagttcgagctgttcttgccgcaggaatgcagccaattctttgcgttggtgaaagtctt
aaagaacgtcaacagggtgttgcgctggattttgctgtagggcaagtgcatgatgtaacg
cgcgatttggatgcgaagcaagctaagcgtttaattattgcgtacgagccagtttgggca
attggtacgggtatggttgccactgctaactcagctcaggaagctgcattggctattcgt
gaagacttgcgcgttacgttcggtgacgatgttgcagatactgttcgtattctttacggc
ggatctgtaacttcttctaatgcttcaagtcttattgctgagcctgatgttgacggattt
ttggttggtggagcttctttggatgcagaggagttgtcgaatattgtgcgactcaccgca
gcacaatcgcgtctatag

DBGET integrated database retrieval system