KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0927Help
Entry
HMPREF0424_0927   CDS       T01146                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gva00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gva00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1058850..1060085)
Genome map
AA seq 411 aa AA seqDB search
MTNAISSSLHQTFSRSTIANSLAGKSVVTLDDISTAQIRMLLDKARYIDSHRKEVAHTCD
GRVLATLFYEPSTRTRLSFETAMLRLGGKVIGFAGAQLSSASKGETVNDTLKVVSNYVDV
VAMRHPKEGAAFVATQAVSTPIINAGDGGHMHPTQTLADLATILARFGRLNNLTVGLCGD
LTYGRTVHSLIETLCRFGNVHFVLISPDELKTPQYVIDRIIDTPSCTYEETRDLMEVIGK
LDVLYMTRVQEERFTDREQYLRLRDTYILTEEKLQKAKSHMPVLHPLPRINEIAVDVDDD
PRAAYFEQVKNGMLMRMALESSVLGDELCGYGPTDFVNVPEDELQAVDAHGISLTDPRVH
TTDENAPETLTCPNPRCITNSELTLKRKFYKADSVRHEYRCMYCDEEAETK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgcaatttctagttctttacatcaaactttttctcgcagcacaattgcaaat
tctctagctggcaaaagtgttgttacattagacgatatttcaactgcgcaaatacgaatg
cttttagacaaagcgcgatacattgattcgcaccgtaaagaagtggctcacacttgcgat
ggcagagtgttggccactcttttttatgagccgagcacgcgcactcgcttaagcttcgaa
acagcaatgctgcgtttaggcggaaaagtaatcggttttgcaggtgcgcaactttccagc
gcgagcaaaggtgagactgtaaacgatactttgaaagtcgtgtctaactatgtcgatgtt
gttgcaatgcgtcacccaaaggagggtgctgcttttgttgcaacgcaagctgtgagcacg
cctattattaacgctggcgacggcggtcacatgcacccaactcaaactcttgcagacttg
gcaacgattcttgcgcgtttcggccgccttaataatctcactgtcggcttgtgcggcgac
ttaacatatggtcgcacggttcactcgcttattgaaactttgtgccgctttggaaacgtt
cattttgtgctgattagcccggatgagcttaaaactccgcagtacgtaatcgaccgtatt
attgacactccttcgtgcacttatgaagaaactcgcgacttgatggaagttattggcaag
cttgacgtgctttacatgactcgcgtgcaagaagaacgttttacggatcgcgagcaatac
ttgcgacttcgtgacacgtacattttgactgaagaaaaattgcaaaaagcaaagtcgcat
atgcctgtgctgcatccgcttcctcgaattaacgagattgctgttgatgttgacgacgat
ccgcgcgcagcatactttgagcaggttaaaaacggtatgcttatgcgtatggctttggaa
agttccgttcttggcgacgagctttgcggctacgggccaactgattttgtgaacgttcca
gaagacgaattgcaagcggttgatgcacacggaatttcattaacggatcctcgcgttcac
acaaccgacgagaatgcgcctgaaactcttacatgcccgaatcctcgttgcataacaaac
agcgaactaactcttaaacgcaagttctacaaagctgattccgtaaggcacgagtatcgc
tgcatgtattgcgacgaagaagcagaaactaagtaa

DBGET integrated database retrieval system