KEGG   Gardnerella vaginalis 409-05: HMPREF0424_1011Help
Entry
HMPREF0424_1011   CDS       T01146                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0424_1011
   01230 Biosynthesis of amino acids
    HMPREF0424_1011
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_1011
  Energy metabolism
   00680 Methane metabolism
    HMPREF0424_1011
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0424_1011
Enzymes [BR:gva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0424_1011
Exosome [BR:gva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0424_1011
  Exosomal proteins of melanoma cells
   HMPREF0424_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142014..1142832)
Genome map
AA seq 272 aa AA seqDB search
MVDFVENVASNVNNSINSAHEGIARSVMLIRHGQTPYNAQFRLQGMIDIALDESGMDQVT
RSGKALRVLFGASDLEDPKDPNSTEHVRITPEEADASFVAIVSPLIRAQQTAHAFADKIG
LHVHVENGVRERFFGEWEGLNRQQISEQWPEDFKAWVEGKSGELRHGAEAKQEVGERAAA
AVEDWARKTGADRDLLVFSHGSCLSQTVHKLLGLDKVDPSYKTIGGMGNGRWARLIPSLN
AEGSIHWRLDAYDQGPAADPTSQRLIRIWGAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggttgatttcgtagaaaatgttgcgagtaacgtaaataattccattaatagtgcgcat
gaaggaattgctcgttctgttatgcttattcgccacggtcaaactccgtataatgcacag
ttccgtttgcaaggcatgattgatattgctttggatgagtctggaatggatcaggtgact
cgctctggaaaagctttgcgcgtgctttttggtgcttctgatttagaagatccaaaggac
ccgaacagcactgaacacgtgcgcattacgccagaagaagcggacgcgagttttgtggcg
attgtttctccacttattcgcgctcaacagactgctcatgcttttgcagataagattggg
cttcatgtgcatgttgaaaatggtgtgcgcgagcgtttctttggcgagtgggaaggtttg
aatcgtcagcagattagcgagcagtggccggaagatttcaaagcttgggttgaaggtaaa
agcggagagcttcgtcatggtgctgaagctaagcaggaagtaggagagcgcgctgctgct
gcagtagaagattgggctcgcaaaactggcgcagaccgtgatttgctagtattttcgcat
ggttcctgtctttcgcaaactgttcataagctgcttggattagataaagtagatccttct
tacaagacgattggcggcatgggaaacggtcgttgggcgcgcttaattccaagtcttaac
gctgagggttcgattcattggcgtttggatgcttatgatcaaggtcctgcagctgaccct
acaagccagcgtcttattcgcatttggggtgctgcgtaa

DBGET integrated database retrieval system