KEGG   Gardnerella vaginalis 409-05: HMPREF0424_1019Help
Entry
HMPREF0424_1019   CDS       T01146                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gva01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gva00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:gva00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148957..1150483
Genome map
AA seq 508 aa AA seqDB search
MAADTTIFHSTRSLKPTCTSKEAIRKGIAEDGGLFVADSLGSERYDISKLQGKSYQEIAQ
DILQLLLPDYTSEELSSCIKLAYGNQWANNAITPLQQLGNTSDFVMELFHGPTCAFKDVA
LQMLPQLMSRTKTQHENESDIEKSVMILTATSGDTGKAALAGFADVPGTSMVTFYPEGKV
SRVQELQMTTQVGENVKVCAVRGNFDDAQTGVKQIFTNSELNKNIEESANTELSSANSIN
VGRLVPQVVYYFAAYKQLVERKAIALGDEIEFCVPTGNFGDILAGYYAKMLGLPVKHLIV
ASNSNNVLFDFLVSGTYNRQRTFHHTVAPSMDILVSSNLERMLYYMCDKDTRLIQMLMND
LQQWGAFEIPENVLAKIRSLFGCGWANEDQIREAIYDCWNKYKYVIDPHTACGFFVMQNI
PHDESTPRVLLSTASPYKFPRVVAEALNIEHVQDMNDFKCMDALSKATGTKAPSMLRNLE
NKTPRFNDVINVEDMPEYVLAQAHNFAK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatacaactattttccatagcactcgttcgcttaagccaacatgcacatca
aaagaggcaatacgtaaaggaattgctgaagatggcggattatttgtagctgatagcctt
ggtagcgaacgttacgatatttctaaattgcaaggcaaatcgtatcaagaaattgcgcag
gatattttgcaactgttgctgcctgattatacttcagaagagctttcttcttgcattaaa
ctggcatacggcaatcaatgggctaataacgctattactccacttcagcagcttggaaac
actagcgattttgttatggaacttttccatggtcctacttgcgcgtttaaagacgttgct
ttgcaaatgttgccacaattaatgtctcgcactaaaactcaacacgagaacgaatctgat
attgaaaaaagcgttatgattctaactgcaacttctggagatacaggtaaagctgctttg
gctggttttgctgatgttccaggcacttctatggttactttttatccagaaggaaaagtt
agccgcgttcaagaattgcaaatgactacgcaggtgggcgaaaatgtgaaagtttgcgca
gttcgaggcaattttgacgatgctcaaactggcgtaaaacagattttcaccaatagtgag
cttaataaaaatattgaagaatctgcgaatactgaattgtcttctgctaattcaataaat
gttggacgactcgtgccgcaagtcgtgtactattttgcggcttataagcaacttgttgag
cgtaaagcaatagctcttggagacgaaattgagttttgcgtaccaaccggcaattttggc
gatattcttgctggatattacgcaaaaatgcttggtcttcctgtaaaacatcttattgtt
gcaagcaatagcaataatgttttgtttgattttttggtaagcggcacttataaccgtcag
cgcacattccatcacactgttgctccttctatggatattttggtttcttctaatttggaa
cgaatgctttattacatgtgcgataaagacacgcgtttaatacaaatgcttatgaacgat
ttacagcagtggggcgcttttgagattccagaaaatgtgcttgcaaagattcgctcactg
tttggctgcggttgggcaaatgaagatcaaattcgcgaagctatttatgactgctggaac
aagtacaagtatgtaatcgacccacatactgcttgcggattcttcgttatgcaaaatatt
ccacatgacgaaagcacacctagagtattgctaagcactgcaagcccatacaaattccct
cgcgttgttgctgaagctttgaatattgagcatgtgcaagatatgaatgatttcaaatgc
atggacgctcttagtaaagctacaggaactaaagctccaagcatgcttagaaatcttgaa
aataaaactccacgctttaatgatgttattaatgttgaagatatgcctgagtatgtttta
gctcaagcgcataatttcgcaaaataa

DBGET integrated database retrieval system