KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20043Help
Entry
HMPREF0421_20043  CDS       T01344                                 

Gene name
recR
Definition
recombination protein R
Orthology
K06187  
recombination protein RecR
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0421_20043 (recR)
DNA repair and recombination proteins [BR:gvg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HMPREF0421_20043 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42418..43026)
Genome map
AA seq 202 aa AA seqDB search
MHNVSSYDGAIGRVIDAFSKLPGIGPKGAQRIAFYILSSSDVQTQDLIGAISDLRENVRF
CEICGNVCEQSPCVICQDPRRDHTKICVVEEPKDIMSIERTHEYAGVYHVLGGAINPMAN
VGPADLKITQLLERLKDAQVKEVILALDPNIEGEATVTYLARLLEPLDISITRLASGLPV
GGDLEYADEITLGRAFAGRQEV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcataacgtgtcatcgtatgacggtgcaataggcagagttattgatgcgttctctaag
cttccaggaataggaccaaaaggcgcgcagcgaattgcattctatatactttcatcatct
gatgtacaaacgcaggatttaattggcgcaatcagtgacttgcgcgagaatgtgcgattt
tgtgaaatttgcggaaatgtttgcgagcaaagtccttgtgttatttgccaagatccgcga
agagatcacacaaaaatatgcgttgtagaagagccaaaagacattatgagcattgagaga
actcacgaatacgctggcgtttaccacgttttgggcggtgccattaatccaatggcaaac
gttggacctgcagacttaaaaataacgcaactacttgagcgcttaaaagacgcgcaagta
aaagaagtcattttagcgcttgacccaaatattgaaggagaagctacagtaacttattta
gcacgtttgcttgagccgcttgacataagtattacgcgacttgcaagcggattgccagtt
ggtggagacttagagtatgcagacgagataactcttggtcgcgcatttgcaggaagacaa
gaagtatag

DBGET integrated database retrieval system