KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20174Help
Entry
HMPREF0421_20174  CDS       T01344                                 

Gene name
glcK
Definition
(RefSeq) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
gvg00010  Glycolysis / Gluconeogenesis
gvg00052  Galactose metabolism
gvg00500  Starch and sucrose metabolism
gvg00520  Amino sugar and nucleotide sugar metabolism
gvg00521  Streptomycin biosynthesis
gvg01100  Metabolic pathways
gvg01110  Biosynthesis of secondary metabolites
gvg01120  Microbial metabolism in diverse environments
gvg01130  Biosynthesis of antibiotics
gvg01200  Carbon metabolism
Module
gvg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0421_20174 (glcK)
   00052 Galactose metabolism
    HMPREF0421_20174 (glcK)
   00500 Starch and sucrose metabolism
    HMPREF0421_20174 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0421_20174 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0421_20174 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF0421_20174 (glcK)
Enzymes [BR:gvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF0421_20174 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Salt_tol_Pase
Motif
Other DBs
NCBI-GeneID: 9903713
NCBI-ProteinID: YP_003985283
UniProt: E3D7V2
Position
194921..195919
Genome map
AA seq 332 aa AA seqDB search
MNETKDSRPTYLAFDIGGTKIAYGLVTLPDSNIRQENADYVSPTVQEHGSMLTEAAKGGE
SIKNRLVEKASQIIEEAQKNGKTISGIGIAAAGVPNSKTGEIVAATDILPGWRGQRIYDA
FKSVTDLPVYMIGDVGGHGLGEAIYGAGRGKSIVFSVGIGTGIGGAIIINGKLFTGAHGV
AGHAGHVVSDLGVGFDCSCGAHAGHIEPVASGTGLATLYNSNLPQGAELAQNGYEICVRA
NSGQDAHAKETLARSGKALGECVAGMANLIDPDVIVLSGSVVEAGDIWWNAMRSGFEDSA
LTLIKNTPILKGQLGGSAPLIGAAWAVHSNRV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaaagattctcgccctacatatcttgcttttgacataggcggaacaaaa
atcgcctatggattggtgactttgccagattctaatattcgccaagaaaatgcagattac
gtatctccaacagtgcaagagcatggttcaatgctaacagaagctgcaaaaggtggagaa
agtataaagaatcgcttagtggaaaaagcgtcgcaaatcatagaagaagcgcagaaaaat
ggcaaaactattagcggaattggaatagcggctgcgggagtgccaaatagtaaaactggc
gaaattgtagctgctacagacattctgccaggttggcgagggcagcgaatttatgacgca
tttaagagcgtaactgacttgccagtttatatgattggcgatgttggtggacatggttta
ggcgaagcaatttacggcgcgggtcgcggaaagtcgattgtattttctgttggcataggc
actggaattggtggggcgattattataaacggtaagctgtttacaggagcgcacggagtt
gctgggcatgcgggtcacgttgttagtgacttgggagtaggttttgactgctcttgcgga
gcacatgcgggccacattgagccagtggcttcgggaacggggcttgccactctttacaat
agcaatcttccacaaggcgccgagcttgcgcaaaacggctatgagatttgtgtgcgcgca
aattctgggcaggatgcgcacgccaaagaaacgcttgctagaagcggcaaggccttggga
gagtgcgtagctggaatggcgaatcttatagatccagatgtgattgtgctttctgggtct
gttgtagaagctggcgatatttggtggaatgctatgcgaagcggatttgaagattctgct
ttgacattgattaagaatacgccaattttaaagggtcaactcggaggatctgctcctttg
attggtgctgcttgggctgttcactcaaatcgcgtttaa

DBGET integrated database retrieval system