KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20202Help
Entry
HMPREF0421_20202  CDS       T01344                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
gvg00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0421_20202 (rbsK)
Enzymes [BR:gvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0421_20202 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-GeneID: 9903742
NCBI-ProteinID: YP_003985311
UniProt: E3D853
Position
229775..230839
Genome map
AA seq 354 aa AA seqDB search
MHCYSKLDSLSGLENIASLRLNDLKVTQENMQESHKADSNAIAIVGSMNADYTIVADRLP
NPGETINGNEIRVLPGGKSGNQAVSAAKLGAHVKMFGAVGNDSNADFLLNSLQSSGVDTT
CVRRVENKKSGATVITVDAHSGENTIVYAPGSNSLVDCEYIQSPLVKSALTSAKVLGLCL
ESPLETVTMCAQLAHENGVKVLLNDSPFLNKLPKDLIDSADILLVNEHEMAQLLNIEEPD
DGDWYSFDWNHVAHAMHDFGFDEAVVTLGSKGSVVLDYSKEDCVCMISPQNVKAVDTTGC
GDAFMGTILACLSVDMRLDEAAALASYVSAYAATGFGAQASYGTVEQIRQFFNV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcattgttatagtaagcttgattcgttaagtggattagaaaatattgcgtcgctccgc
ttaaacgatttaaaagttacgcaagagaatatgcaagaatcacataaagcggattcaaac
gctattgcaatagtcggctctatgaatgcggattatactattgtggcagatcgtcttcct
aacccaggagaaaccattaatggaaacgagattcgcgtgttgccaggtggaaaatctggt
aatcaagctgtatcggctgcaaaactcggtgcacacgttaaaatgtttggtgcagttggc
aatgattccaatgctgattttctcctaaattctttgcaatcttccggagttgatacaact
tgtgttcgtcgcgtagaaaataaaaagagtggcgcaactgtgattactgtagatgcgcat
agtggggaaaatactattgtgtatgctccaggatctaattctttagtagattgtgagtat
attcaatcgccgttagtaaaatccgctcttactagcgcaaaagttcttggtctttgttta
gaaagtcctttagaaactgtaactatgtgcgcacaactagcgcatgaaaatggcgtaaaa
gtgcttcttaacgattcgccatttttaaacaagttgcctaaagatttgattgattctgcg
gatattttgcttgttaacgagcatgagatggcgcaacttttgaatattgaagagccagat
gatggcgattggtattcttttgattggaatcatgtagctcacgctatgcatgattttggc
tttgatgaagctgtagttactcttggctctaaaggctctgtagtgttggattattcaaaa
gaggattgcgtatgcatgatttcccctcagaacgttaaagctgttgatacaactggctgc
ggtgatgcttttatgggcacaatattagcttgtttgtctgtagatatgcgtttagacgaa
gctgccgcgttagcgtcttatgtttctgcgtatgcagctactggttttggcgctcaagct
tcttatggcacagttgaacaaattcgtcaattttttaatgtttaa

DBGET integrated database retrieval system