KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20324Help
Entry
HMPREF0421_20324  CDS       T01344                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gvg01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gvg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393287..394432
Genome map
AA seq 381 aa AA seqDB search
MINKAVEPTEDEIRRSISNANTIVVKVGSSSLTDLSGHLDVQKLRALVTAISRAQMSGAN
VVLVSSGAIAAGFGLLGFNERPKDVPTQQATASVGQGLLMYQYESAFAEFGIRVGQMLLT
ADVTISPSRYRNAQRTMLRLLELGVVPIVNENDALSSNEIRFGDNDRLAALVANIVRADA
LVLLTDVDALYTAPPSEPDAKRISFVPDVTRALDDVKVGSSISGVGTGGMITKMDAAHVA
AVSGIPTLLTCASNAEGALSGKAVGTVFAPLNSRASSRRLWIGFASNPHGSIIVDSGAAA
AVRGGKASLLAAGIVGVAGDFSASDPVWIDDEHGNHLAKGLVAFDSDEIPQVMGLTTDDL
EATLGRQYAHPVVHRDNLVLL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaggcagttgagcctaccgaagatgagattcggcgttcaattagcaatgcg
aacacaatagtcgtaaaagttggctctagctcgcttacagacttatctggtcatttagac
gtgcaaaaattacgtgctcttgttacggctattagccgtgctcaaatgtctggagctaat
gtagttttagtatcttctggtgctatcgcagcgggatttggactacttggttttaatgaa
cgtcctaaagatgtgcctactcagcaagcaacagcatcagttggacaaggcttgctcatg
taccaatatgagtcagcatttgcggaattcggcataagagtagggcaaatgctactaacg
gcagacgttactataagtccttcgcgttaccgtaatgcccaacgcacaatgcttaggctg
ctggaattaggcgttgtgccaatcgtaaacgaaaacgacgctctgtctagcaacgaaata
cgttttggtgataacgataggcttgcggcgcttgtggcgaacattgtgcgagcagatgcg
ctggttcttttaacagatgttgacgcgctttacacggctccgcctagcgaaccagatgct
aagcggattagttttgttcccgatgttacgcgcgcgctagacgatgttaaagttggctcc
agcatttcgggtgtaggcacaggcggaatgataaccaaaatggatgcggcgcacgttgct
gctgtttctggaatcccaacgcttttgacatgtgctagtaacgcggagggcgcactatcg
gggaaagcagttggaaccgtgttcgcgccactaaattcgcgcgcgtcttccagaagactt
tggattggttttgcgtctaatccgcatggctcgattattgtagattctggtgcagctgca
gccgttcgaggagggaaagcaagcctgctggctgctggaatagtaggagttgctggcgac
ttttctgcaagcgatccagtgtggattgatgacgagcatggcaatcatttagccaaaggg
ctagttgcatttgattcagatgagataccgcaggtaatgggtcttactacggacgattta
gaggcgactttggggcggcaatacgcacatcctgtggtgcatcgcgataatcttgtgctt
ttataa

DBGET integrated database retrieval system