KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20324Help
Entry
HMPREF0421_20324  CDS       T01344                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0421_20324 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HMPREF0421_20324 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HMPREF0421_20324 (proB)
Enzymes [BR:gvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HMPREF0421_20324 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393287..394432
Genome map
AA seq 381 aa AA seqDB search
MINKAVEPTEDEIRRSISNANTIVVKVGSSSLTDLSGHLDVQKLRALVTAISRAQMSGAN
VVLVSSGAIAAGFGLLGFNERPKDVPTQQATASVGQGLLMYQYESAFAEFGIRVGQMLLT
ADVTISPSRYRNAQRTMLRLLELGVVPIVNENDALSSNEIRFGDNDRLAALVANIVRADA
LVLLTDVDALYTAPPSEPDAKRISFVPDVTRALDDVKVGSSISGVGTGGMITKMDAAHVA
AVSGIPTLLTCASNAEGALSGKAVGTVFAPLNSRASSRRLWIGFASNPHGSIIVDSGAAA
AVRGGKASLLAAGIVGVAGDFSASDPVWIDDEHGNHLAKGLVAFDSDEIPQVMGLTTDDL
EATLGRQYAHPVVHRDNLVLL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaggcagttgagcctaccgaagatgagattcggcgttcaattagcaatgcg
aacacaatagtcgtaaaagttggctctagctcgcttacagacttatctggtcatttagac
gtgcaaaaattacgtgctcttgttacggctattagccgtgctcaaatgtctggagctaat
gtagttttagtatcttctggtgctatcgcagcgggatttggactacttggttttaatgaa
cgtcctaaagatgtgcctactcagcaagcaacagcatcagttggacaaggcttgctcatg
taccaatatgagtcagcatttgcggaattcggcataagagtagggcaaatgctactaacg
gcagacgttactataagtccttcgcgttaccgtaatgcccaacgcacaatgcttaggctg
ctggaattaggcgttgtgccaatcgtaaacgaaaacgacgctctgtctagcaacgaaata
cgttttggtgataacgataggcttgcggcgcttgtggcgaacattgtgcgagcagatgcg
ctggttcttttaacagatgttgacgcgctttacacggctccgcctagcgaaccagatgct
aagcggattagttttgttcccgatgttacgcgcgcgctagacgatgttaaagttggctcc
agcatttcgggtgtaggcacaggcggaatgataaccaaaatggatgcggcgcacgttgct
gctgtttctggaatcccaacgcttttgacatgtgctagtaacgcggagggcgcactatcg
gggaaagcagttggaaccgtgttcgcgccactaaattcgcgcgcgtcttccagaagactt
tggattggttttgcgtctaatccgcatggctcgattattgtagattctggtgcagctgca
gccgttcgaggagggaaagcaagcctgctggctgctggaatagtaggagttgctggcgac
ttttctgcaagcgatccagtgtggattgatgacgagcatggcaatcatttagccaaaggg
ctagttgcatttgattcagatgagataccgcaggtaatgggtcttactacggacgattta
gaggcgactttggggcggcaatacgcacatcctgtggtgcatcgcgataatcttgtgctt
ttataa

DBGET integrated database retrieval system