KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20400Help
Entry
HMPREF0421_20400  CDS       T01344                                 

Gene name
rmlCD
Definition
bifunctional dTDP-4-keto-L-rhamnose reductase/dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:gvg00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gvg00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484720..486162)
Genome map
AA seq 480 aa AA seqDB search
MEFEKELSVTKTNIPGLIVFDLPVHGDNRGWFKENWQRAKMTALGLPDFGPVQNNISFNE
KRGVTRGIHAEPWDKYISIATGEVFGAWVDLRPGKSFGQVYTTTLNPSKAIYVPRGVGNS
FQALQDGTAYTYLVNAHWSLEQKKTYTFVNLADPDLHINWPIPLEESERSEADLHHPMLK
NAKPMAPKRTLVTGCNGQLGRAIQNYAKENNLEGFEYVDLDSFDIANKDDYSRYDWDLYG
TIINTAAYTSVDGAQTLQGRRAAWNSNVKGVANLAKIAQEHHITLVHISSDYVFDGTQEN
HKENEDFAPLGVYGETKAAADSLVANVPQHYIIRSSWIVGEGRNFVTRMIDFANRLKNGE
SVSVQAPIDQTGRLTFASDLVKGMFHLLNTQAQYGTYNLTGSGKIASWHDIAQKVFTQLN
VDTSKIEANRVDDYTRISNGSPRPHKCALDLQKIESAGFTPCDWEDLLESYVNRIEQNNK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaaaaagaactaagcgttacaaaaaccaatattccaggtttaatcgtgttt
gatcttccagtacacggagataaccgcggatggttcaaagaaaactggcagcgcgcaaaa
atgacggctctaggtctccccgactttggacccgtacaaaacaacatttcgttcaacgaa
aaacgcggagtaaccagaggcatccacgcagagccatgggataaatacataagcattgct
actggcgaagtatttggcgcatgggtggatttaagaccaggtaaaagcttcggtcaagtg
tacacaaccacactaaaccctagcaaagcaatctacgttcctagaggcgtaggaaacagc
ttccaagctttgcaagatggcacggcatacacttatttagtaaacgcacattggtcacta
gagcaaaagaaaacatacacttttgtaaaccttgcagacccagatttacacattaattgg
ccaatacctttagaagaatccgagcgcagcgaagctgacttacaccacccaatgctaaaa
aacgcaaagccaatggcaccaaaacgcactcttgtaactggatgcaacggtcaacttggt
cgcgcaatacaaaattatgctaaagagaataatttagaaggatttgagtacgtagactta
gatagcttcgatatagcaaataaagacgattacagccgctacgactgggatttgtacgga
acgattattaacacagcagcatacacgtctgtagatggcgcgcaaacgctacaagggcga
agagccgcgtggaatagcaacgttaaaggagtggcaaatcttgcaaaaatagcgcaagaa
caccacattactcttgtgcacatctcaagcgactatgttttcgacggcactcaagaaaat
cacaaagaaaacgaagactttgcaccactaggcgtgtacggcgaaacaaaagctgcagca
gattctctagtagcaaacgttccacagcattatattattcgctcaagctggattgtcgga
gaaggacgaaactttgtaacgcgcatgattgactttgcaaaccgtttaaaaaatggcgaa
tctgttagtgttcaagcgccaatagatcaaactggcagactcacttttgcaagcgactta
gtaaaaggcatgttccatcttctaaacactcaagcacaatacggaacatacaatcttaca
ggttcaggaaaaatcgcgtcttggcacgatattgctcaaaaagtgtttacacaacttaat
gtagacacaagcaaaatcgaagcaaatcgcgtagacgattacacgcgcatatctaatggc
tctcctagaccacacaagtgcgcacttgacttacaaaaaatcgaatccgctggatttacg
ccatgcgattgggaagatttgcttgaatcttacgtaaatagaattgaacaaaacaacaag
taa

DBGET integrated database retrieval system