KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20538Help
Entry
HMPREF0421_20538  CDS       T01344                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0421_20538 (gpmA)
   01230 Biosynthesis of amino acids
    HMPREF0421_20538 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0421_20538 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0421_20538 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0421_20538 (gpmA)
Enzymes [BR:gvg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0421_20538 (gpmA)
Exosome [BR:gvg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0421_20538 (gpmA)
  Exosomal proteins of melanoma cells
   HMPREF0421_20538 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
665296..666036
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGVEEAKHGGELLKEKNVLPDIVFTSLLR
RAINTANYALDAADRLWIPVRRSWRLNERHYGALQGKNKSEIRQEYGDEKFMIWRRSYAT
PPPEIDPNDEYSQTNDPRYAGDPVPETEALANVVTRVTPYWESDIIPELKSGKTVMIAAH
GNSLRAIVKMLDNLSEEEISKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacatataaattagtattgctccgacatggtcagagcgcatggaataagaccaatcag
ttcactggttgggttgatgtaccgctgactgagcagggtgttgaggaagctaagcatggt
ggcgagcttcttaaagagaagaacgttcttccagacatcgtgttcacttctttgcttcgt
cgcgctatcaataccgcgaattacgcgcttgatgcagccgaccgcctgtggattccagtt
cgtcgcagctggcgtttaaacgagcgtcattacggtgctttgcaaggtaagaataagtct
gagattcgtcaggaatatggcgatgagaagttcatgatttggcgtcgttcttacgcaact
ccacctcctgagattgatccaaacgatgagtattctcagacgaatgatcctcgttacgca
ggcgatccggttccagaaactgaagctttggcaaacgttgtgactcgtgtaactccttac
tgggagtccgatattattccagagcttaagtctggcaagactgtgatgattgcagctcac
ggcaacagcttgcgcgcaatcgttaagatgcttgacaacttgagcgaggaagagatttcc
aaggtgaatattccaaccgctattcctctgctttacgagttggatgagaactttaagcca
atcaagcctcgtggtgagtatttggatccagaagctgctgctgctggtgctgccgctgtg
gctgctcagggtcagaagtga

DBGET integrated database retrieval system