KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20760Help
Entry
HMPREF0421_20760  CDS       T01344                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gvg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939119..939736
Genome map
AA seq 205 aa AA seqDB search
MVSLNDTQSMPVATKRRLIVLTGPTAAGKGTVEGVLREKHPNIWLSVSATTRKPRYDEFN
GIHYWFIDEEEFERRKRNGEFLETALVHGMAHYGTLIQPVLDHLAQNVPTLLEIDLQGAR
RVKQEASRLGLEVVYVFIAPPSFEELKRRLIGRGTETPEQQAKRLQTAKVEMAASSEFDF
VIVNDDAQRAADELWKIIAKEYDLD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggttagtttaaacgatacacagagtatgccagtcgctactaaaaggcgtttgattgtt
cttactggtcctactgcagctggtaagggcactgttgagggagtattgcgcgaaaaacat
cctaatatttggctttctgtttctgcgactaccagaaaacctcgttatgatgagtttaat
ggaattcattattggttcattgatgaagaagagtttgagcgcaggaagaggaacggagag
tttctggagactgctcttgttcatggaatggcacattatggtactttaattcagcctgtt
ttagatcatcttgctcaaaacgttccaacgcttctagagattgatcttcagggagctagg
agagttaagcaggaagcttctagattaggtttagaagtcgtatacgtatttattgcccct
cctagctttgaggagcttaagcgtcgacttattggtagaggcactgaaactcctgagcag
caggctaagcgtttgcaaaccgctaaagtagaaatggctgcgtctagcgagtttgatttt
gtgattgttaatgacgatgctcagcgcgctgcagatgaactttggaagataatagctaaa
gaatacgatttagattaa

DBGET integrated database retrieval system