KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20768Help
Entry
HMPREF0421_20768  CDS       T01344                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0421_20768 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF0421_20768 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0421_20768 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0421_20768 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0421_20768 (tpiA)
Enzymes [BR:gvg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0421_20768 (tpiA)
Exosome [BR:gvg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0421_20768 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0421_20768 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0421_20768 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948654..949451
Genome map
AA seq 265 aa AA seqDB search
MVVNRKPLVAGNWKMNFNHLEATHFIQKFWWRLCDSHFDCKKCDIALMPSFTSLRSVQVL
VESDNLPILYGAQAVSVTAQGAFTGDVSADMLASLGCSMVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERKQGIELDFAVGQVHDVTRDLDSKQAERLIIAYEPVWA
IGTGMVATAQSAQDAAKAIRDDLQETFGDTVSQKVRILYGGSVTSSNAASLICEPDVDGF
LIGGASLDIEELATIVQLSSYKNRI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcaataggaaaccgctagttgcaggcaattggaagatgaattttaatcacctc
gaagccactcattttattcaaaaattctggtggcgtctatgtgattctcacttcgactgt
aaaaaatgcgatattgctcttatgccatcgtttacgtccttaagaagcgtgcaagtatta
gttgagtctgataatcttcctattctttatggcgcgcaagcagtttccgttacagctcaa
ggcgcgtttactggagatgtttctgcagatatgcttgcaagcttgggctgctcaatggtg
attgtaggtcattctgagcgacgtaagtatcatccagaagatgatgcgaatattgttgac
caagtgcgagctgtgcttgctgctggaatgcaacctattctttgcgttggtgaaagtttt
gaagagcgcaagcagggtatagagcttgattttgcagttggacaggttcatgacgttact
cgcgatttggattctaagcaggcagagcgtttgattattgcatacgaaccagtttgggct
attggaactggaatggtagctacagcacagtctgctcaagatgctgctaaggctattagg
gatgatctgcaggaaactttcggggatactgtatcacaaaaagttagaatactttatggc
ggctctgtaacgtcttctaatgcagcaagtcttatttgtgagccagacgttgatggattt
cttattggtggagcttctttagacattgaggaattggctactattgttcaattgtcgtct
tacaaaaatcgaatttaa

DBGET integrated database retrieval system