KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20797Help
Entry
HMPREF0421_20797  CDS       T01344                                 

Gene name
ppgK
Definition
polyphosphate-glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:gvg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gvg00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gvg00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974027..974797
Genome map
AA seq 256 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRYKILTPAVSTPQAVADIVRQQLEHFDV
PADVPVGIAFPAPIKPGKKLEFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QHFGAAKDKDGLVIATTLGTGIGTALIYNGTLIPNTELGHIQLEKGKGDAEKYAASSVRE
KLDMGYKKWAKRLTKYYGLMEKYFNPDLFVVGGGVSRVSEKFLPHIDIKTPIVVASLHNE
AGIIGAAYYAMQQRNN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcatttggcgtagatattggtggctctggtattaaggctgca
ccagttaatttggaaaaaggcgagtttgcagaaccgcgatataagattctcactccagcg
gtttccacacctcaagctgttgcagatattgttcgtcagcaacttgagcattttgatgtt
cctgcagatgttcctgttggaatcgcttttccagctcctattaagcctggaaagaagctt
gagtttatggcgaatctcgatcaatcttggattggtgtggatgttacagaagtgttcagc
gaagcttgcggtcgtcctgttactgtagtgaatgatgctgatgctgctggtcttgctgag
caacactttggtgctgcaaaagataaagatggcttggttatcgctactacgctaggcact
ggaattggcacagcattgatttataacggtactcttattcctaatacagagctcggtcat
attcagcttgaaaagggtaagggagatgcggaaaagtatgctgcttcttctgttcgcgaa
aagttagacatgggttataaaaagtgggctaagcgtcttactaagtattatggtttgatg
gaaaagtactttaacccagacttgttcgttgttggaggcggtgttagccgtgttagcgag
aagttcttgcctcatatcgatattaagacgcctattgtagttgcgtctttgcataatgaa
gccggcattatcggtgcagcttattatgcaatgcagcaaagaaacaattaa

DBGET integrated database retrieval system