KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20826Help
Entry
HMPREF0421_20826  CDS       T01344                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0421_20826
   00052 Galactose metabolism
    HMPREF0421_20826
   00500 Starch and sucrose metabolism
    HMPREF0421_20826
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0421_20826
Enzymes [BR:gvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0421_20826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1007824..1008879)
Genome map
AA seq 351 aa AA seqDB search
MGDTFELSAAKMREQGMSEIAINQFAHLYDSWINDKSGEFIRENTVEPIKSVPNFHEIYE
TIDHDKAVNAFAKTAFIKLNGGLGTSMGLSCAKSLLPVRRHKARQMRFIDIIIGQVLTAR
QRLGVDLPLIFMNSFRTSKDTLQVLKRNRKFSQENIPVEIIQHQEPKLLEETCEPVSYPE
DPELEWCPPGHGDIFSTIWESGLLNVLKKNGIEYLFISNSDNLGARPSRTLAQHFENTGA
SIMIEVAKRTQADRKGGHIVRDLETGRMMLREMTQVHPEDRRSAQSIKKHPYFNTNNIWV
RVDALQKKLEEYNGVLPLPVICNRKTIDPTNEKKRESYSAGNCDGCCNFAF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacttttgaattgtccgctgcaaagatgcgcgaacaaggtatgagtgagatt
gcgattaatcaatttgcgcatctttatgactcgtggattaatgataagtctggtgaattt
attcgcgaaaacactgtagagcctattaagagtgttccaaattttcacgaaatttatgag
actattgatcatgataaagctgtaaacgcttttgcaaaaacagcgtttattaagcttaat
ggtggtttgggaacgtctatgggattgtcgtgcgcaaaatctttgttgcctgtccgtagg
cacaaagctcgacaaatgcgatttatagatataataatcggtcaggttcttacagcacgc
caacgcttaggtgttgatttacctcttatttttatgaactctttccgcacatctaaagat
acattacaagtgctgaagcgtaatcgtaaattttctcaagaaaacattcctgttgaaatt
attcagcatcaagaaccgaaattgctagaggaaacctgtgagccagtttcttatccagaa
gatcctgagttagagtggtgtcctccaggtcatggagatattttctctacaatttgggaa
tcaggattgttaaacgttttgaagaaaaatggtattgaatatttatttatttcaaattca
gataatttaggcgctagaccttctcgtactcttgctcagcactttgaaaacacgggtgct
tcaataatgattgaggttgctaagcgtactcaagccgatcgtaaaggtggtcatattgtt
agagatctcgaaactggaagaatgatgcttcgagaaatgactcaagttcatccagaagat
cgaagaagtgctcaaagtattaagaaacatccctattttaatacaaataatatttgggtt
cgcgttgacgcattacaaaaaaagttggaagaatacaatggagttcttcctcttcctgtg
atttgcaatagaaaaactattgatcctacaaatgaaaaaaagcgagaaagttattcagct
ggaaactgcgatgggtgctgcaatttcgctttttaa

DBGET integrated database retrieval system