KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20826Help
Entry
HMPREF0421_20826  CDS       T01344                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
gvg00040  Pentose and glucuronate interconversions
gvg00052  Galactose metabolism
gvg00500  Starch and sucrose metabolism
gvg00520  Amino sugar and nucleotide sugar metabolism
gvg01100  Metabolic pathways
gvg01130  Biosynthesis of antibiotics
Module
gvg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0421_20826
   00052 Galactose metabolism
    HMPREF0421_20826
   00500 Starch and sucrose metabolism
    HMPREF0421_20826
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0421_20826
Enzymes [BR:gvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0421_20826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 9904392
NCBI-ProteinID: YP_003985931
UniProt: E3DA14
Position
complement(1007824..1008879)
Genome map
AA seq 351 aa AA seqDB search
MGDTFELSAAKMREQGMSEIAINQFAHLYDSWINDKSGEFIRENTVEPIKSVPNFHEIYE
TIDHDKAVNAFAKTAFIKLNGGLGTSMGLSCAKSLLPVRRHKARQMRFIDIIIGQVLTAR
QRLGVDLPLIFMNSFRTSKDTLQVLKRNRKFSQENIPVEIIQHQEPKLLEETCEPVSYPE
DPELEWCPPGHGDIFSTIWESGLLNVLKKNGIEYLFISNSDNLGARPSRTLAQHFENTGA
SIMIEVAKRTQADRKGGHIVRDLETGRMMLREMTQVHPEDRRSAQSIKKHPYFNTNNIWV
RVDALQKKLEEYNGVLPLPVICNRKTIDPTNEKKRESYSAGNCDGCCNFAF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacttttgaattgtccgctgcaaagatgcgcgaacaaggtatgagtgagatt
gcgattaatcaatttgcgcatctttatgactcgtggattaatgataagtctggtgaattt
attcgcgaaaacactgtagagcctattaagagtgttccaaattttcacgaaatttatgag
actattgatcatgataaagctgtaaacgcttttgcaaaaacagcgtttattaagcttaat
ggtggtttgggaacgtctatgggattgtcgtgcgcaaaatctttgttgcctgtccgtagg
cacaaagctcgacaaatgcgatttatagatataataatcggtcaggttcttacagcacgc
caacgcttaggtgttgatttacctcttatttttatgaactctttccgcacatctaaagat
acattacaagtgctgaagcgtaatcgtaaattttctcaagaaaacattcctgttgaaatt
attcagcatcaagaaccgaaattgctagaggaaacctgtgagccagtttcttatccagaa
gatcctgagttagagtggtgtcctccaggtcatggagatattttctctacaatttgggaa
tcaggattgttaaacgttttgaagaaaaatggtattgaatatttatttatttcaaattca
gataatttaggcgctagaccttctcgtactcttgctcagcactttgaaaacacgggtgct
tcaataatgattgaggttgctaagcgtactcaagccgatcgtaaaggtggtcatattgtt
agagatctcgaaactggaagaatgatgcttcgagaaatgactcaagttcatccagaagat
cgaagaagtgctcaaagtattaagaaacatccctattttaatacaaataatatttgggtt
cgcgttgacgcattacaaaaaaagttggaagaatacaatggagttcttcctcttcctgtg
atttgcaatagaaaaactattgatcctacaaatgaaaaaaagcgagaaagttattcagct
ggaaactgcgatgggtgctgcaatttcgctttttaa

DBGET integrated database retrieval system