KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20865Help
Entry
HMPREF0421_20865  CDS       T01344                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0421_20865 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0421_20865 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0421_20865 (thrC)
Enzymes [BR:gvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0421_20865 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056677..1058194
Genome map
AA seq 505 aa AA seqDB search
MAENTTNTVMFHSTRSSSKTYTSKQAIRRGIADDGGLFVTDCLGETRYDISNLSGKTYKQ
IAKDVLQILLPDFTSSELDDCVEKAYGSQWEDTEITPLKALGNNNDFVLELFHGPTCAFK
DVALQILPQFISHTKDVSDSNQNVMILTATSGDTGKAALAGFADVEGTSMVTFYPEGKVS
KIQELQMTTQSGDNVKVCAVRGNFDDAQSGVKQIFTNNSINETVENNNHALLSSANSINI
GRLIPQVVYYFYAYSKLVEQGVIELGDEVEFCVPTGNFGNILAGYYAKMLGLPVKHLIVA
SNSNNVLFDFLVSGTYNKIRPFNQTIAPSMDILVSSNLERMLYYMCDKDTRLLQMLMNDL
QQWGAFEIPDNVLSKIRKLFGCGWANEKQIRDSIKECWDNHNYVIDPHTACGYFVMNHIP
HDSNVPRVLLSTASPYKFPRVVCQSLGLNVQDLDDFGCMELLEKKTSTKSPSMLSELKNK
TARFNDVINVEDMPDYVLKCANEIC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaacactacgaatacagttatgtttcacagcactaggtcaagctctaaaacc
tatacctcgaagcaagctattcgtagaggaatagcagatgatggtggattatttgttaca
gattgccttggtgaaactcgttacgatatttctaatctttctggaaaaacttataaacag
attgctaaagatgttcttcaaattctccttccagattttacatctagcgagcttgatgat
tgtgtagagaaggcttatggaagtcagtgggaagatactgaaattactcctttaaaggct
cttggcaataataatgactttgttctagagcttttccacggtcctacctgtgcttttaaa
gatgttgctttgcaaattttgccgcaattcattagtcacacaaaagatgtatctgattct
aatcaaaatgttatgattcttacagccacttcgggagatacaggaaaagctgcgttagct
gggtttgcggatgttgaaggcacttctatggtcactttttacccagaaggtaaagtaagt
aaaattcaagaattgcaaatgaccactcaaagtggagataacgtaaaagtatgtgctgtt
agaggaaattttgacgatgcacaaagcggcgttaaacaaatatttactaacaattcaatt
aatgaaacagttgaaaacaataatcacgcactgctttcttctgctaattcgattaatatt
ggcagacttattcctcaagttgtttactacttctacgcttattctaaacttgttgagcaa
ggcgttattgaacttggtgatgaagtggaattttgtgtccctactggaaattttggaaat
attcttgctggatattatgcgaaaatgcttggtcttcctgtaaaacacttgattgtagca
agcaacagcaacaatgttttgtttgactttttggtcagtggaacatataacaagattcga
ccatttaaccaaacaattgcaccgtctatggatattcttgtttcttctaatttagaacgc
atgctttactacatgtgcgataaagatacaagactgttgcaaatgcttatgaatgattta
caacaatggggcgcttttgaaataccagataatgttctttctaaaattaggaaacttttt
ggttgcggatgggcaaacgagaagcagattcgcgactctataaaagaatgttgggataat
cataattatgttatagacccgcatactgcttgcggatactttgttatgaatcatattcct
catgattctaatgttccgcgtgttcttttgagcaccgcaagcccttacaaattcccgagg
gttgtttgccagtctctgggattaaacgttcaagacttagatgactttggatgcatggag
cttcttgaaaagaaaacctctactaagtcgcctagtatgttgagtgaacttaagaataag
actgctcgctttaatgatgttattaacgtcgaagatatgccagattatgttcttaagtgc
gctaacgaaatttgctga

DBGET integrated database retrieval system