KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20973Help
Entry
HMPREF0421_20973  CDS       T01344                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Brite
Enzymes [BR:gvg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     HMPREF0421_20973 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 9904543
NCBI-ProteinID: YP_003986078
UniProt: E3DAG1
Position
complement(1194365..1195186)
Genome map
AA seq 273 aa AA seqDB search
MVDFVESATQIAHNANKNSAHEGIARSVMLVRHGQTPYNAQFRLQGMIDIALDESGIDQV
TRSGKALRVLFGASDLEDPKNPNSEEHVRITPEEADASFVAIASPLIRAQQTAHAFADKI
ELNVHVENGVRERFFGEWEGLNRQQINEKWPEDFKSWVDGKGGELNHGAETKQEVGERAA
KAVEDWARKTGSDRDLLVFSHGSCLSQTVHKLLGLDKVDPSYKTIGGMGNGRWARLIPSL
NADGSIHWRLDAYDQGPAADPTSQRLIRIWGAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttgttgaaagcgcaacgcaaattgcgcataatgccaataaaaacagcgct
cacgaaggtattgcgcgttctgtaatgcttgttcgccatggccagacgccttataatgca
caatttagacttcaaggcatgattgatattgctttagatgagtctggaatagaccaggtg
actcgctctggtaaggctttgcgtgttctttttggagcttccgacttagaagacccaaag
aatccaaatagcgaggagcacgtgcgcattactccagaagaagcagacgcgagttttgtt
gcaattgcttctccgcttattcgcgcacaacagacagctcatgcttttgcagataagatt
gagcttaatgttcacgttgaaaatggtgtgcgcgagcgcttttttggagagtgggaaggc
cttaatcgccagcaaattaacgaaaaatggcctgaagattttaagtcatgggttgatggc
aaaggtggtgaactcaaccacggtgcagaaactaagcaagaagttggcgagcgcgcggcg
aaagctgttgaggattgggcgcgcaaaactggctcggatcgcgatttgctagtgttttcg
cacggctcttgcctatctcaaactgttcataagcttcttggattagacaaggtagatcct
tcttataagacgattggtggaatgggaaacggtcgttgggcgcgtttaattccaagtctt
aacgcggatggttcaatccattggcgtttggatgcttacgatcaaggccctgcagccgac
cctacaagtcagcgtcttattcgcatttggggagcggcttaa

DBGET integrated database retrieval system