KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20973Help
Entry
HMPREF0421_20973  CDS       T01344                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0421_20973 (gpm)
   01230 Biosynthesis of amino acids
    HMPREF0421_20973 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0421_20973 (gpm)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0421_20973 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0421_20973 (gpm)
Enzymes [BR:gvg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0421_20973 (gpm)
Exosome [BR:gvg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0421_20973 (gpm)
  Exosomal proteins of melanoma cells
   HMPREF0421_20973 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1194365..1195186)
Genome map
AA seq 273 aa AA seqDB search
MVDFVESATQIAHNANKNSAHEGIARSVMLVRHGQTPYNAQFRLQGMIDIALDESGIDQV
TRSGKALRVLFGASDLEDPKNPNSEEHVRITPEEADASFVAIASPLIRAQQTAHAFADKI
ELNVHVENGVRERFFGEWEGLNRQQINEKWPEDFKSWVDGKGGELNHGAETKQEVGERAA
KAVEDWARKTGSDRDLLVFSHGSCLSQTVHKLLGLDKVDPSYKTIGGMGNGRWARLIPSL
NADGSIHWRLDAYDQGPAADPTSQRLIRIWGAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttgttgaaagcgcaacgcaaattgcgcataatgccaataaaaacagcgct
cacgaaggtattgcgcgttctgtaatgcttgttcgccatggccagacgccttataatgca
caatttagacttcaaggcatgattgatattgctttagatgagtctggaatagaccaggtg
actcgctctggtaaggctttgcgtgttctttttggagcttccgacttagaagacccaaag
aatccaaatagcgaggagcacgtgcgcattactccagaagaagcagacgcgagttttgtt
gcaattgcttctccgcttattcgcgcacaacagacagctcatgcttttgcagataagatt
gagcttaatgttcacgttgaaaatggtgtgcgcgagcgcttttttggagagtgggaaggc
cttaatcgccagcaaattaacgaaaaatggcctgaagattttaagtcatgggttgatggc
aaaggtggtgaactcaaccacggtgcagaaactaagcaagaagttggcgagcgcgcggcg
aaagctgttgaggattgggcgcgcaaaactggctcggatcgcgatttgctagtgttttcg
cacggctcttgcctatctcaaactgttcataagcttcttggattagacaaggtagatcct
tcttataagacgattggtggaatgggaaacggtcgttgggcgcgtttaattccaagtctt
aacgcggatggttcaatccattggcgtttggatgcttacgatcaaggccctgcagccgac
cctacaagtcagcgtcttattcgcatttggggagcggcttaa

DBGET integrated database retrieval system