KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_21161Help
Entry
HMPREF0421_21161  CDS       T01344                                 

Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0421_21161
Enzymes [BR:gvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0421_21161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1393088..1394134)
Genome map
AA seq 348 aa AA seqDB search
MNIYERVSMIEKTTPLSNENLANALKKIGESQNHVAVLGSMNADYTIVADRLPNPGETVN
GSDLRVLPGGKSGNQAVSAAKIGANVQMFGAVGSDENAEFLLNTLESAGVDTSKILRVEG
IKSGATVITVDAKAGENTIVYAPGSNAKVSVEYISQEDVKKAISSASVLGLCLESPMETV
TEAAKIARTAGVKVLLNNSPFVNTLPSDLIENASILLVNEHEMAQLLKIHEPEDGNWDDF
DWFDAARIMHEYGFDEAVVTLGAEGSVVLDYNAEDGKKAVRICPQKVSAVDTTGCGDAFM
GTVLAGLAAGFSLAQSAQVATYVSAYAATGFGAQSSYGSAQQVVRAFE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttatgaaagggtttctatgatagaaaaaactactccgttaagcaacgaaaat
cttgctaacgcgcttaaaaaaataggcgaaagtcaaaatcatgttgctgtactaggttcc
atgaacgcagattacacaatagttgccgaccgtcttccaaatcctggagaaactgtaaac
ggaagtgatttgcgagtactaccaggaggaaaatctgggaatcaagccgtttctgcagca
aaaatcggcgcgaatgtgcaaatgtttggtgctgtaggcagcgacgaaaacgcagaattc
cttcttaacacgctagaatctgcaggtgtagacacgtctaaaattttacgtgtagaaggc
ataaaaagtggcgcaacagtaataacagtagatgcaaaagctggcgaaaacacaatcgtc
tatgctccaggttctaatgcaaaagtaagtgtggaatatattagtcaagaagatgttaag
aaggctattagcagtgcaagcgttttaggattgtgccttgaaagcccaatggaaactgta
acggaggctgcaaaaattgcgcgcacagctggtgtaaaagttttacttaataattcgccg
tttgtaaacacgcttccaagtgatctgattgaaaacgcaagcatactgcttgtaaacgag
catgaaatggcgcaattgcttaaaattcacgagccagaagatggcaattgggatgatttt
gactggtttgatgcggcgcgcattatgcacgagtatggtttcgacgaggcagttgtgact
cttggtgcagaaggctctgttgttttagattacaatgcggaagatggtaaaaaggctgtt
cgtatatgcccgcaaaaagtttctgcagtagacaccacgggatgcggtgacgcatttatg
ggaaccgttttggcaggacttgcagctggatttagtttagctcaaagtgcgcaagtggca
acatatgtttctgcgtacgcagcaacaggatttggagcgcaatcgtcttacggcagcgcg
caacaggtggttcgtgcgtttgagtag

DBGET integrated database retrieval system