KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_21247Help
Entry
HMPREF0421_21247  CDS       T01344                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0421_21247 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0421_21247 (ebgA)
Enzymes [BR:gvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF0421_21247 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1545715..1548732)
Genome map
AA seq 1005 aa AA seqDB search
MVESVNDWENPSLTGKNRLPARAYFLSYECSSLAKTYKREFAHGYVCLNGKWKFALLKSP
NSVRKYMKTELQSNWDEVNVPHMWQFDGYGQLQYTDEAFPFPVDPPRVPTLTPTAVYQKE
IIISSIDDDEEIILRCDGIESYGEVYLNGRYVGMTKGSRLSAEFDITEAVVEGTNLFSIV
VMQYCDGTYLEDQDMWWASGIFRDIYVYRRPKVHLKDFFARTHLLDDGRACLSFDATISG
TSSFSCSIEDNGIVVSRIEQKVPNGEVHTKMYIDNPHLWNPEDPYLYDMVITVTSDTGSN
EVVSHRLGLVEISIKDGLMYLNGKYFVMHGVNRHDFDQNKGRAIDIADVKHELIMMKQHN
INAIRTSHYPNDPRFYQLCDELGFMVVAETDLECHGFEHVGNISMISDDSDWQLAYVSRI
EREVFQERNHACIVMWSLGNESGFGCNFRAMYHRCKELDPTRPVHYEEDRFGEVVDVLST
MYSRVSQMNDFGEHPTKKPRILCEYAHSMGNGPGGLQEYQKVIDCYPSIQGHFVWEWCDH
GIAQVDSQGRSYNAYGGDFHDYPNDGNFSIDGLVFPWKAASPGLLEYKQVLCPVHVDLDG
EYIVITNKRYFTDLDDIRIDLSLSENGHAIYNTTISPGELHPSNTIRVKLNIPKLGSNVG
ELLITAYVYSLHRYWWNDEHSPLGVYQYCYRAGNIELPCSQEKCSVFRPDIKVDEDYITI
TSKSQKYVFDRISGDLIHWYNASHDMIKTPIHFDIWRPLIDNYRQEYNELWKPNFLDIMQ
LDTRSVNWKSCDDIAEVTVEQRFAPPVLSFGMKLNSRYVVNSSGVLNLEICAEAYGSYKD
IIPRVGLTFAMPREYDNITWYGRGPGETYPDSCSSQVVGLWEASVDDMITPYVRPQDYGN
HQNTRWVSVRNSSGVGILVTRLSSSSMTDGFSYSAWPFTSNTIEQAKHRNELHEDDLVTI
NLNDQILGLGSNSWGSEVLDSHRIRFENCNFAFSFMPICDNATMD
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaagtgttaatgattgggagaacccttcgttgactggtaaaaatagattaccg
gctcgagcatatttcttaagttatgagtgttctagtttagcaaaaacttataagcgtgaa
tttgcgcatggatatgtatgtttaaatggaaaatggaaatttgcattattgaaaagtccc
aattctgtccgaaagtatatgaaaacagaattacaatccaattgggatgaagtaaatgtt
cctcatatgtggcagtttgatggttatggtcaactgcaatatactgacgaagcatttcct
tttcctgttgatcctcctagagttccaactttgactccaacggctgtttatcagaaggaa
ataataatttcatctattgacgatgatgaagagattattttgcgttgcgacggtattgaa
agttatggtgaagtctatctaaatggcagatatgttggaatgacaaaaggatcgcgtctt
tctgctgaatttgatattactgaagccgtagttgaaggcacgaatttattctctatcgtt
gtaatgcaatattgcgatggaacgtatcttgaagatcaagatatgtggtgggctagtgga
atttttcgtgatatatatgtatatcgtagaccaaaggtacatttgaaagatttcttcgct
cgcactcatttattagatgatggtagagcctgtttatcttttgacgctacaataagcgga
acttcttctttttcatgcagtattgaggataatggtattgttgtttcgcgtattgagcaa
aaggttccaaatggagaagtacatacaaaaatgtatattgacaatccgcatctttggaat
cctgaagacccatatttatatgacatggtaattactgttacaagtgatactggatctaac
gaagttgtgtcgcatcgtcttgggctcgttgaaataagcattaaagatggtctcatgtat
cttaatggtaagtattttgttatgcatggagttaatcgtcatgattttgatcagaataaa
ggtcgtgctattgatattgctgatgtgaaacatgagcttataatgatgaaacagcataat
ataaatgcaatacgcacttctcattatcctaatgatcctaggttttatcaattatgtgat
gagcttggttttatggttgttgctgaaactgatctcgaatgtcatgggtttgaacatgtt
ggtaatatctccatgattagtgatgattctgattggcaactagcttatgtgtcacgcatt
gaacgtgaagtgtttcaagagcgtaatcatgcgtgtattgttatgtggtctcttggtaat
gaatcggggtttggatgtaatttccgggctatgtaccatagatgcaaagagcttgaccca
acgcgaccagtacattatgaggaagataggtttggtgaagttgttgatgttctttcaact
atgtattcgagagtttctcaaatgaatgattttggtgaacatccaacaaaaaagccaaga
atattgtgtgaatatgcacattctatgggcaatggtcctggtgggttacaggaatatcag
aaggttattgattgttatcctagtattcaagggcattttgtttgggaatggtgtgatcat
ggaattgctcaagttgattcgcagggtcgttcatataatgcgtatggcggagatttccat
gattacccaaatgatggcaactttagcatcgatggtcttgtttttccatggaaagcggca
agccctggtctattagagtataaacaggttttatgtccagttcatgtagatttagatggt
gaatatatagttataaccaataagcgttattttactgaccttgatgatattcgtattgat
ctttcattgagtgagaatggtcatgccatctataatacgactatctctccaggagagtta
catccttctaatacgatacgtgtgaaattaaatattcctaaactaggttcaaatgttgga
gagttattaataactgcttatgtttatagtttgcatcgttattggtggaatgatgagcat
tctccgcttggtgtatatcagtattgttatcgggctggtaatatagaactaccatgttcg
caagaaaaatgttctgtatttcgaccagatattaaagttgatgaagactatattactatc
acatcgaaatcgcagaaatatgtgtttgacagaatttctggtgatctcatacattggtac
aatgcttcccatgatatgattaaaactccgattcattttgatatttggcgacctcttatt
gataattatcgacaagagtacaatgaattatggaagcctaatttcttagatattatgcaa
ttagatactcgttccgttaattggaagagttgtgatgatattgctgaagtcactgtagaa
cagagatttgctcctcctgtgttatcgttcggaatgaaattaaatagtaggtatgttgta
aattcgtctggagtgcttaatcttgaaatatgcgctgaagcttatggtagttataaagat
attattccgcgtgtgggattaacttttgctatgcctcgagagtatgacaatattacttgg
tatggtcgtggtccgggtgaaacatatccagattcttgtagttctcaagttgttggactc
tgggaagccagtgtcgacgatatgataactccatacgttcgtccgcaagattatggaaac
catcaaaatacgcggtgggtatctgtgcgtaatagtagtggggtaggtattttagtaacg
cgtttgtctagtagttctatgactgatggattctcttattctgcttggccgtttacttcc
aatactattgaacaggcgaagcatagaaatgaattacatgaagatgatcttgttacaata
aatctcaatgatcaaatattgggtttgggatctaactcatggggcagtgaggttttagat
tctcatagaattcgttttgagaattgtaatttcgctttttcctttatgcctatttgcgat
aatgcaacaatggattga

DBGET integrated database retrieval system