KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_21285Help
Entry
HMPREF0421_21285  CDS       T01344                                 

Gene name
adh2
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0421_21285 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0421_21285 (adh2)
   00620 Pyruvate metabolism
    HMPREF0421_21285 (adh2)
   00650 Butanoate metabolism
    HMPREF0421_21285 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0421_21285 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0421_21285 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0421_21285 (adh2)
   00626 Naphthalene degradation
    HMPREF0421_21285 (adh2)
Enzymes [BR:gvg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0421_21285 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0421_21285 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1575049..1577772)
Genome map
AA seq 907 aa AA seqDB search
MIEEDQMAQAQEKAQETVLDEKEQSALAAKREVDELAKKAKVALEEFEKLNQEQVDRIVA
KASIAALNKHLVLAKMAVEETGRGLVEDKATKNIFACEHITHYLAGQRTVGIIREDDVLG
IDEIAEPVGIVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPFAQKCSAEAARVVRDA
AIEAGAPENCIQWIEHPSIEATGALMKHPDVATILATGGPGMVKAAYSSGKPALGVGAGN
APAYVDADVDVVRAANDLVLSKHFDYGMICATEQAIIAHKDVYEPLLKELKRRKAYFVNA
DEKAKLEQYMFGCTSYSGQTPKLNSVVPGKSPQYIAHEAGFDIPEDAVILIAECKEVGEM
EPLTMEKLAPVHALLRADNKEQGFEMCEKMLVHGAGHTAVIHTNNQQLAREYGSRMHACR
IIWNSPGSLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLINIKRIARRNNNMQWF
KIPAKTYFEPNAVRYLRDMYGIERAVIVCDKVMEQLGIIDKVIDQLRARDNRVTFRIIDY
VEPEPSVETVERGAEMMREEFQPDTIIAVGGGSPMDAAKIMWLLYEHPEISFADLREKFF
DIRKRAFKIPPLGKKACLICVPTSSGTGSEVTPFAVITDHKTGYKYPITDYAITPSVAIV
DPVLARTQPRRLACDSGFDALTHSMEAFASVYANDFTDAMALHAAKLIWDNLNDSVNSNN
SERKIQAQEKMHNAATMAGMAFGSAFLGMCHAMAHTIGALCHVAHGHTNAILLPYVIRYN
GQIPQEPTSWPKYNRYIAPERYQQIAKNLGIDPGKTPQEGVENLARAVENYRDNLLSMDA
SFKACGVDEEYYWSLLDQIGMRAYEDQCAPANPRIPQIEDMKDIAIAAYYGVSQEEGHRM
RLERESK
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggaggaccaaatggcgcaggcgcaagaaaaggcgcaagaaacagtgcttgat
gaaaaagagcaatccgcattagcagccaaacgagaagtagatgaattagctaaaaaagca
aaggttgctttagaagagtttgaaaaattaaatcaggagcaagtagacagaatagtagca
aaagcgtctattgcagcgttaaacaagcatttagtcttagcaaaaatggctgttgaagaa
acaggcagaggattagttgaagataaagccacaaaaaacatttttgcatgcgaacacatt
acccattatcttgcaggccagcgcacagtaggcattattcgcgaagatgatgttcttgga
atcgatgaaatcgctgagccagttggcatagtagcaggcgtgactccagtcacaaaccca
acatctacagccatttttaaatcgctaattgctcttaaaactcgttgcccaattattttt
ggcttccatccattcgctcaaaaatgctccgcagaagcggcaagagttgtgcgcgatgca
gcgatagaagcaggcgcgccagaaaattgcattcagtggattgaacatccatcaatcgaa
gctacgggagctttaatgaagcacccagatgttgcaacaattcttgcaacaggcggtcct
ggaatggttaaggctgcttattcttcgggtaagccagcacttggcgttggtgcaggaaac
gctccagcatatgttgatgcggacgtagatgttgtgcgcgctgcaaacgatttggtgctt
tcaaagcattttgattacggtatgatttgcgcaacagagcaggcgattattgcgcataaa
gacgtgtatgagccattgttaaaggaattgaagcgcagaaaagcatatttcgttaacgct
gatgaaaaagcgaaacttgaacagtatatgtttggttgcacttcgtattcaggtcaaact
cctaagcttaattcagttgttccaggaaaatctcctcaatatattgcgcatgaagctggg
tttgatattccagaagatgctgtgatccttattgccgagtgcaaggaagttggcgagatg
gagcctctaacaatggaaaagttggctcctgttcacgctttgcttcgcgcagataacaag
gaacaaggctttgaaatgtgcgagaagatgcttgttcacggagctggtcacactgctgtg
attcacactaataatcagcagcttgctcgcgaatatggcagccgcatgcacgcttgccga
atcatttggaactccccaggatctttgggtggtgttggtgacatctacaacgcaatcgca
ccttctctcactttaggctgtggttcttatggtggaaactctgtttctggaaatgttcaa
gcagtaaatcttattaatataaagcgcatagcgcgaaggaataataatatgcagtggttc
aagattccggccaaaacgtattttgagccgaatgctgttcgctatttgcgagacatgtat
ggcattgagcgcgcagttattgtgtgcgataaagttatggagcagcttggcattatagac
aaggtaattgatcagcttcgcgctagagacaatcgcgtaacgtttaggattattgactac
gttgagccagagccaagcgttgaaactgttgaacgcggcgccgaaatgatgcgcgaagag
ttccagccagatacgattattgctgttggcggcggatctcctatggatgctgcaaaaatt
atgtggcttctttacgagcatccagaaatttccttcgctgatttgcgcgaaaagttcttc
gatattagaaagcgcgcatttaagattccgcctcttggtaaaaaggcttgcttgatttgt
gtaccaacgtcttctggaacaggatcggaagttactccgtttgcagttattacagatcat
aagactggctacaagtacccaattactgactacgcaattacgccttcggtggcaatcgtg
gatccagttttggcacgcacacagcctcgtcgcttggcttgcgattctggttttgacgct
ttgacgcactctatggaagcttttgcttctgtttatgctaacgactttacggacgcaatg
gcattgcatgcagcaaagttgatttgggataatcttaacgattctgtgaattccaataat
tccgaacgcaagattcaagctcaagaaaaaatgcataatgcggctactatggctggaatg
gcgtttggttcggcgttccttggtatgtgccacgcaatggcacatacaatcggagctttg
tgccatgttgctcacggccacacgaatgcaattttgctgccttatgtgattcgctacaat
ggtcaaattccacaagagcctacaagctggccaaagtacaatcgctacatcgctccggag
cgataccagcagattgcaaagaatcttggcatagatcctggtaaaactcctcaagagggc
gttgagaatttggcgcgcgctgttgaaaattatcgagataatcttcttagtatggatgct
tcgtttaaggcatgcggtgtggatgaagaatactattggtctttgttggatcagattggc
atgcgtgcttacgaagatcagtgcgctcctgcaaatcctcgtattcctcaaatcgaagat
atgaaagatattgcgattgcagcgtattatggtgtttcccaagaagaaggacatcgtatg
cgtttggagcgcgaatctaagtga

DBGET integrated database retrieval system