KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0053Help
Entry
HMPREF9231_0053   CDS       T01939                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9231_0053
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9231_0053
   00052 Galactose metabolism
    HMPREF9231_0053
   00500 Starch and sucrose metabolism
    HMPREF9231_0053
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9231_0053
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF9231_0053
   00524 Butirosin and neomycin biosynthesis
    HMPREF9231_0053
Enzymes [BR:gvh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF9231_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57858..58859
Genome map
AA seq 333 aa AA seqDB search
MNETKDSRPTYLAFDIGGTKIAYGLVTLPDSNIRQENADYVSPTVQEHGSMPTEAAKGGE
NIKNRLVEKVSQIIEEAQKNGKTISGIGIAAAGVPNSKTGEIVAATDILPGWRGQRIYDA
FKSVTDLPVYMIGDVGGHGLGEAIYGAGRGKSIVFSVGIGTGIGGAIIINGKLFTGAHGV
AGHAGHVVSDLGVGFDCSCGARAGHIEPVASGTGLATLYNRNLPAGTQEAQNGYDVCVRA
NSGEEYAKEILARSGKALGECVAGMANLIDPDVIVLSGSVVEAGDIWWNAMRSGFEDSAL
TLIKNTPILKGQLGGSAPLIGAAWAVHLSLNHF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaaagattctcgccctacatatcttgcttttgacataggtggaacaaaa
attgcctatggattggtgactttgccagattctaatattcgccaagaaaatgcagattac
gtatctccaacagtgcaagagcatggttcaatgccaacagaagctgcaaaaggtggagaa
aatataaagaatcgcctagtggaaaaagtgtcgcaaatcatagaagaagcgcagaaaaat
ggcaaaactattagcggaattggaatagcggctgcgggagtgccaaatagtaaaactggc
gaaattgtagctgctacagacattctgccaggttggcgaggacagcgaatttatgacgca
tttaagagcgtaactgacttgccagtttatatgattggcgatgttggtggacatggttta
ggcgaagcaatttacggcgcgggtcgcggaaagtcgattgtattttctgttggcataggc
actggaattggtggggcgattattataaatggtaagctgtttacaggagcgcacggagtt
gctgggcatgcgggtcacgttgttagtgacttgggagtaggttttgactgctcgtgcgga
gcgcgtgcgggccacattgagccagtggcttctggaacggggcttgcgactctttacaat
cgaaatcttccagctggtactcaagaagcccaaaatggttatgatgtttgcgtaagagca
aattctggtgaggaatatgcaaaagaaattcttgctagaagcggtaaggctttgggtgag
tgcgtagctggaatggctaatcttatagatccagatgtgattgtgctttctgggtctgtt
gtagaagctggtgatatttggtggaatgctatgcgaagtggatttgaagattctgctttg
acattgattaagaacaccccaattttaaagggtcaacttggaggatctgctcctctgatt
ggcgctgcttgggctgttcatttaagtttgaaccatttttaa

DBGET integrated database retrieval system