KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0237Help
Entry
HMPREF9231_0237   CDS       T01939                                 

Gene name
malQ_2
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9231_0237 (malQ_2)
Enzymes [BR:gvh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF9231_0237 (malQ_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
270130..272298
Genome map
AA seq 722 aa AA seqDB search
MNNKNEESTQQTSPLRRLAELMGVRSKFVGSDGIEHQIADNVLVKVLRSLCVDASTDKAI
EESMQKILLERHTRLVAPTVLHTVGKEDTVIINTGILEYPTATLILEDGEQYQGDLQISP
CKDDVAFPVNGTFVASSLLTIPADVPMGYHTLRISVADRVEEASLISAPESIDTLEKLEK
DGKQIWGWMAQLYSIRSSKSWGVGDYADLADLLVQSKKKTGADFVLVNPLHAGEPVAPLT
PSPYLPVARGMVNVTYIRPEIIPEYDSLNDKDRKTVDDLHNEVEPLNNDAQIVDRDSMWR
VKMHALWIIFKSGLSAERSEEFEAFKQDMGERLESYATWCLCYDKWGAPKGEDCWEKHLT
KDSDEISALCKQFPDTLEFYRWLEWIAFTQLHDAQVAAKNAGMRIGIMSDMAVGVHPAGS
EVWWNPERFANGACVGAPPDYFNQQGQNWSQPPLNPFELERTGFKVYKDMVHGMFSSAGA
VRIDHILGLFRLWWIPEGSTPGDGAYVYYDADVMLGILAIEATRANGVVVGEDLGVVPTE
TLEVLAKNKVLGCTVEWFEQRDGAFREPKKWREMTLASVNTHDLPPAAGYLNYEHVNIRE
RLNLLSGSVEEFRAGAVKEHNAMLKMLVSGGFLDKKALENESEHEQEIVEALYRALKAAP
SKLLAASIVDATGEHRAQNQPGTNDEYPNWRIPLADANCNPVLLDNLFDLPRVKSLAQIM
NK
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaaaatgaagaaagtactcagcaaacaagcccattaaggcgtttggctgag
ttaatgggagtacgctccaaattcgttggatcggatggaatagaacatcagattgctgat
aacgtgcttgtaaaagtattgcgctctctgtgcgtagatgcaagtactgataaagcgatt
gaagaatcaatgcagaagattcttttggaacgtcatacacgtttagttgctccaacggtg
ttgcatacagttggtaaagaagacactgttataatcaacacaggtattttggagtatcct
acagcaactttgatattggaagatggagaacagtaccaaggtgacttgcagatttctcca
tgtaaagatgatgttgcgttccctgttaatggcacttttgtggcaagctctttgttgaca
attccagcagacgtgcctatggggtatcacactctacgaataagcgttgcggatcgagta
gaagaggcgtcacttattagtgctccagaaagcattgatactctagaaaagcttgaaaaa
gatggaaagcagatttggggatggatggctcagctttattccattcgttcttctaagtct
tggggtgttggcgattacgcagatttagctgatcttcttgtgcaatcaaagaaaaaaaca
ggtgcagattttgtgcttgtaaacccattgcatgcaggtgaaccagttgcaccattaacg
ccgtctccttatttgccagtcgcaagaggaatggttaatgtaacctatattcgcccagaa
ataattccagaatatgattcgcttaatgataaggatcgtaagactgttgacgatcttcat
aacgaagtagagcctcttaataatgatgctcaaattgttgatcgtgactccatgtggcga
gtaaaaatgcatgctttgtggattatttttaagtctgggctttctgctgaacgctccgaa
gaatttgaagcatttaagcaggacatgggtgagcgtcttgaatcttatgcaacttggtgc
ctttgctacgataagtggggtgctcctaagggagaagactgctgggagaagcatcttact
aaagattccgatgagattagcgctttatgtaaacaattcccagatactctagagttttat
cgttggcttgagtggattgcgtttacgcaattgcatgatgctcaagttgcagctaaaaat
gcgggtatgcgcattggcattatgtcggatatggctgttggcgtgcatcctgcaggctcc
gaggtttggtggaatccagagcgatttgccaatggtgcttgcgtaggtgcgcctcctgat
tacttcaatcagcagggtcaaaactggtctcagcctccgcttaatccattcgagcttgag
cgcactggatttaaagtgtacaaagatatggttcacggaatgttttcgtctgctggtgct
gtgcgaattgaccatattcttgggcttttccgcttatggtggattccagaaggatctact
ccaggtgatggagcttacgtttactatgatgcagacgttatgcttggcattcttgcgatt
gaagccacgcgcgcaaatggtgttgtagttggagaagaccttggtgttgtgccaactgaa
actttggaagttttggctaagaataaggttcttggatgcacggttgagtggtttgaacag
agggatggtgcattccgtgagcctaagaagtggcgcgaaatgacgcttgcttctgtaaat
actcacgatttgccaccggctgcaggctacttaaactacgagcacgttaatattcgcgag
cgtttgaatcttctttcgggatccgtagaagaattccgcgctggtgctgttaaagagcat
aatgcgatgctgaaaatgcttgtttctggaggtttcttagacaagaaggctctagaaaat
gaatctgagcatgagcaagagattgtagaagcattatatcgagcacttaaagctgctcct
tccaagctgcttgctgcatccattgttgatgcaacgggtgaacatcgtgctcagaatcag
cctggcaccaatgatgaatatccaaattggcgtattcctttggctgatgctaattgtaat
cctgttcttttagacaacttatttgacttgcctagagttaagtctttagcgcaaatcatg
aataagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system