KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0240Help
Entry
HMPREF9231_0240   CDS       T01939                                 

Gene name
adh
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Benzoate degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:gvh01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gvh00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gvh00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gvh00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gvh00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gvh00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:gvh00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:gvh00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:gvh00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273897..276602
Genome map
AA seq 901 aa AA seqDB search
MAQAQEKAQETVLDEKEQAALAAKREVDELAKKAKVALEEFEKLNQEQVDRIVAKASIAA
LNKHLVLAKMAVEETGRGLVEDKATKNIFACEHITHYLAGQRTVGIIREDDVLGIDEIAE
PVGIVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPFAQKCSAEAARVVRDAAIEAGA
PENCIQWIEHPSIEATGALMKHPDVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVD
ADVDVVRAANDLVLSKHFDYGMICATEQAIIAHKDVYEPLLKELKRRKAYFVNADEKAKL
EQYMFGCTSYSGQTPKLNSVVPGKSPQYIAHEAGFEVPDDAVILIAECKEVGEMEPLTME
KLAPVHALLRADNKEQGFEMCEKMLVHGAGHTAVIHTNNQQLAREYGSRMHACRIIWNSP
GSLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLINIKRIARRNNNMQWFKIPAKT
YFEPNAVRYLRDMYGIERAVIVCDKVMEQLGIIDKVIDQLRARDNRVTFRIIDYVEPEPS
VETVERGAEMMREEFQPDTIIAVGGGSPMDAAKIMWLLYEHPEISFADLREKFFDIRKRA
FKIPPLGKKACLICVPTSSGTGSEVTPFAVITDHKTGYKYPITDYAITPSVAIVDPVLAR
TQPRRLACDSGFDALTHSMEAFASVYANDFTDAMALHAAKLIWDNLNDSVNSNDSERKIQ
AQEKMHNAATMAGMAFGSAFLGMCHAMAHTIGALCHVAHGHTNAILLPYVIRYNGQIPQE
PTSWPKYNRYIAPERYQQIAKNLGIDPGKTPQEGVENLARAVENYRDNLLSMDASFKACG
VDEEYYWSLLDQIGMRAYEDQCAPANPRIPQIEDMKDIAIAAYYGVSQEEGHRMRLERES
K
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcgcaagaaaaggcgcaagaaacagtgcttgatgaaaaagagcaagccgca
ttagcagccaaacgagaagtagatgaattagctaaaaaagcaaaggttgctttagaagag
tttgaaaaattaaatcaggagcaagtagacagaatagtagcaaaagcgtctattgcagcg
ttaaacaagcatttagtattagcaaaaatggctgttgaagaaacaggcagaggattagtt
gaagataaagccacaaaaaacatttttgcatgcgagcatattacccattatcttgcaggc
cagcgcacagtaggcattattcgcgaagatgatgttcttggaatcgatgaaatcgctgag
ccagttggcatagtagcaggcgtgactccagtcacaaacccaacatctacagccattttt
aaatcgctaattgctcttaaaactcgttgcccaattatttttggcttccatccattcgct
caaaaatgctccgcagaagcggcaagagttgtgcgcgatgcagcgatagaagcaggcgcg
ccagaaaattgcattcagtggattgaacatccatcaatcgaagctacgggagctttaatg
aagcacccagatgttgcaacaattcttgcaacaggcggtcctggaatggttaaagctgct
tattcttcgggaaagccagcacttggcgttggtgcaggaaacgctccagcatatgttgat
gcggacgtagatgttgtgcgcgctgcaaacgatttggtgctttcaaagcattttgattac
ggtatgatttgcgcaacagagcaggcgattattgcgcataaagacgtgtatgagccattg
ttaaaggaattgaagcgcagaaaagcatatttcgttaacgctgatgaaaaagcgaaactt
gaacagtatatgtttggttgcacttcgtattcaggtcaaactcctaagcttaattcagtt
gttccaggaaaatctcctcaatatattgcgcatgaagctgggtttgaggttcctgatgat
gctgtgatccttattgccgagtgcaaggaagttggcgagatggagcctctaacaatggaa
aagttggctcctgttcatgctttgcttcgcgcagataacaaggaacaaggctttgaaatg
tgcgagaagatgcttgttcacggagctggtcacactgctgtgattcacactaataatcag
cagcttgctcgcgaatatggcagccgcatgcacgcttgccgaatcatttggaactcccca
gggtccttgggtggtgttggtgacatctacaacgcaatcgcaccttctctcactttaggc
tgtggttcttatggtggaaactctgtttctggaaacgttcaagcagtaaatcttattaat
ataaagcgcatagcgcgaaggaataacaatatgcaatggttcaagattccggccaaaacg
tattttgagccgaatgctgttcgctatttgcgagacatgtatggcattgagcgcgcagtt
attgtgtgcgataaagttatggagcagcttggcattatagacaaggtgattgatcagctt
cgcgctagagacaatcgcgtaacgtttaggattattgactacgttgagccggagccaagc
gttgaaactgttgagcgcggcgcggaaatgatgcgcgaagagttccaaccagatacgatt
attgctgttggcggcggatctcctatggatgctgcaaaaattatgtggcttctttacgag
cacccagaaatttccttcgctgatttgcgcgaaaagttcttcgatattcgtaagcgcgcg
tttaagattccgcctcttggtaaaaaggcttgcttgatttgtgtaccaacgtcttctgga
acaggatcggaagttactccgtttgcagttattacagatcataagactggctacaagtac
ccgattactgactacgcaattacgccttcggttgcaatcgtggatccagttttggcgcgc
acacagcctcgtcgtttggcttgcgattctggttttgacgctttgacgcactctatggaa
gcttttgcttctgtttatgctaacgactttacggacgcaatggcattgcatgcagcaaag
ttgatttgggataatcttaacgattctgtgaattccaatgattctgagcgcaagattcaa
gctcaagaaaaaatgcataatgcggctactatggctggaatggcgtttggttcggcgttc
cttggtatgtgccacgcaatggcgcatacaattggagctttgtgccatgttgcgcacggc
cacacaaatgcgattttgctgccttatgtgattcgctacaatggtcaaattccacaagag
cctacaagctggccaaagtacaatcgctacatcgctccggagcgataccagcagattgca
aagaatcttggcatagatcctggtaaaactcctcaagagggcgttgagaatttggcgcgc
gctgttgaaaattatcgagataatcttcttagtatggatgcttcgtttaaggcatgcggt
gtggatgaagaatactattggtctttgttggatcagattggcatgcgtgcttacgaagat
cagtgcgctcctgcaaatcctcgtattcctcaaatcgaagatatgaaagatattgcgatt
gcagcgtattatggtgtttcccaagaagaaggacatcgtatgcgtttggagcgcgaatct
aagtag

DBGET integrated database retrieval system