KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0275Help
Entry
HMPREF9231_0275   CDS       T01939                                 

Definition
glycosyl hydrolase, family 2
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF9231_0275
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF9231_0275
Enzymes [BR:gvh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF9231_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
302934..305951
Genome map
AA seq 1005 aa AA seqDB search
MVESVNDWENPSLTGKNRLPARAYFLSYECSSLAKTYKREFAHGYVCLNGKWKFALLKSP
NSVRKYMKTELQSNWDEVNVPHMWQFDGYGQLQYTDEAFPFPVDPPRVPTLTPTAVYQKE
IIISSIDDDEEIILRCDGIESYGEVYLNGRYVGMTKGSRLSAEFDITEAVVEGTNLFAIV
VMQYCDGTYLEDQDMWWASGIFRDIYVYRRPKVHLKDFFARTHLLDDGRACLSFDATISG
TSSFSCSIEDNGIVVSRIEQKVPNGEVHTKMYIDNPHLWNPEDPYLYDMVITVTSDTGSN
EVVSHRLGLVEISIKDGLMYLNGKYFVMHGVNRHDFDQNKGRAIDIADVKHELIMMKQHN
INAIRTSHYPNDPRFYQLCDELGFMVVAETDLECHGFEHVGNISMISDDSDWQIAYVSRI
EREVFQERNHACIVMWSLGNESGFGCNFRAMYHRCKELDPTRPVHYEEDRFGEVVDVLST
MYSRVSQMNDFGEHPTKKPRILCEYAHSMGNGPGGLQEYQEVIDCYPSIQGHFVWEWCDH
GIAQVDSQGRSYNAYGGDFHDYPNDGNFSIDGLVFPWKAASPGLLEYKQVLCPVHVDLDG
EYIVITNKRYFTDLDDIRIDLSLSENGHAIYNTTISPGELHPSNTIRVKLNIPKLGSNVG
ELLITAYVYSLYRYWWNDEHSPLGVYQYCYRVGNIELPCSQEKCSVFRPDIKVDEDYITI
TSKSQKYVFDRISGDLIHWYNASHDMIKTPIHFDIWRPLIDNYRQEYNELWKPNFLDIMQ
LDTRSVNWKSCDDIAEVTVEQRFAPPVLSFGMKLNSRYVVNSSGVLNLEICAEAYGSYKD
IIPRVGLTFAMPREYDNITWYGRGPGETYPDSCSSQVVGLWEASVDDMITPYVRPQDYGN
HQNTRWVSVRNSSGVGILVTRLSSSSMTDGFSYSAWPFTSNTIEQAKHRNELHEDDLVTI
NLNDQILGLGSNSWGSEVLDSHRIRFENCNFAFSFMPICDNATMD
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaagtgttaatgattgggagaacccttcgttgactggtaaaaatagattaccg
gctcgagcatattttttaagttatgagtgttctagtttagcaaaaacttataagcgtgaa
tttgcgcatggatatgtatgtttaaatggaaaatggaaatttgcattattgaaaagtccc
aattctgtccgaaagtatatgaaaacagaattacaatccaattgggatgaagtaaatgtt
cctcatatgtggcagtttgatggttatggtcaactgcaatatactgacgaagcatttcct
tttcctgttgatcctcctagagttccaactttgactccaacggctgtttatcagaaagaa
ataataatttcatctattgacgatgatgaagagattattttgcgttgcgacggtattgaa
agttatggtgaagtctatctaaatggcagatatgttggaatgacaaaaggatcacgtctt
tctgctgaatttgatattactgaagccgtagttgaaggcacgaatttattcgctatcgtt
gtaatgcaatattgcgatggaacgtatcttgaagatcaagatatgtggtgggctagtgga
atttttcgtgatatatatgtatatcgtagaccaaaggtacatttgaaagatttcttcgct
cgcactcatttattagatgatggtagagcctgtttatcttttgatgctacaataagcgga
acttcttctttttcatgcagtattgaggataacggtattgtggtttcgcgtattgagcaa
aaggttccaaatggagaagtacatacaaaaatgtatattgacaatccgcatctttggaat
cctgaagacccatatttatatgacatggtaattactgttacaagtgatactggatctaac
gaagttgtgtcgcatcgtcttgggctcgttgaaataagcattaaagatggtctcatgtat
cttaatggtaaatattttgttatgcatggagttaatcgtcatgattttgatcagaataaa
ggtcgtgctattgacattgctgatgtgaaacatgagcttataatgatgaaacagcataat
ataaatgcaatacgcacttctcattatcctaatgatcctaggttttatcaattatgtgat
gagcttggttttatggttgttgctgaaactgatctcgaatgtcatgggtttgaacatgtt
ggtaatatctccatgattagtgatgattctgattggcaaatagcttacgtgtcacgcatt
gaacgtgaagtgtttcaagagcgtaatcatgcgtgtattgttatgtggtctcttggtaat
gaatctgggtttggatgtaatttccgggctatgtatcatagatgcaaagagcttgatcca
acgcgacccgtacattatgaggaagatagatttggcgaagttgttgatgttctttcaact
atgtattcgagagtttctcaaatgaatgattttggtgagcatccaacaaaaaagccaaga
atattgtgtgaatatgcacattctatgggcaatggtcctggtgggttacaggaatatcag
gaggttattgattgttatcctagtattcaagggcattttgtttgggaatggtgtgatcat
ggaattgctcaagttgattcgcagggtcgttcatataatgcgtatggcggagatttccat
gattacccaaatgatggcaactttagcatcgatggtcttgtttttccatggaaagcggca
agccctggtctattagagtataaacaggttttatgtccagttcatgtagatttagatggt
gaatatatagttataaccaataagcgttattttactgaccttgatgatattcgtattgat
ctctcattgagtgagaatggtcatgccatctataatacgactatctctccaggagagtta
catccttctaatacgatacgtgtgaaattaaatattcctaaactaggttcaaatgttgga
gagttattaataactgcttatgtttatagtttgtatcgttattggtggaatgatgagcat
tctccgcttggcgtatatcagtattgttatagggttggtaatatagaactaccatgttcg
caagaaaaatgttctgtatttcgaccagatattaaagttgatgaagactatattactatc
acatcgaaatcgcagaaatatgtgtttgacagaatttctggtgatctcatacattggtac
aatgcttcccatgatatgattaaaactccgattcattttgatatttggcgacctcttatt
gataattatcgacaagagtacaatgaattatggaagcctaatttcttagatattatgcaa
ttagatactcgttccgttaattggaagagttgtgatgatattgctgaagtcactgtagaa
cagagatttgctcctcctgtgttatcgttcggaatgaaattaaatagtaggtatgttgta
aattcgtctggagtgcttaatcttgaaatatgcgctgaagcttatggtagttataaagat
attattccgcgtgtgggattaacttttgctatgcctcgagagtatgacaatattacttgg
tatggtcgtggtccgggtgaaacatatccagattcttgtagttctcaagttgttggactc
tgggaagccagtgtcgacgatatgataactccatacgttcgtccgcaagattatggaaac
catcaaaatacgcggtgggtatctgtgcgtaatagtagtggggtaggtattttagtaacg
cgtttgtctagtagttctatgactgatggattctcttattctgcttggccgtttacttcc
aatactattgaacaggcgaagcatagaaatgaattacatgaagatgatcttgttacaata
aatctcaatgatcaaatattgggtttgggatctaactcatggggcagtgaggttttagat
tctcatagaattcgttttgagaattgtaatttcgctttttcctttatgcctatttgcgat
aatgcaacaatggattga

DBGET integrated database retrieval system