KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0377Help
Entry
HMPREF9231_0377   CDS       T01939                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF9231_0377
Enzymes [BR:gvh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF9231_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471831..472853
Genome map
AA seq 340 aa AA seqDB search
MIEKTTPLSNENLANALKKIGESQNRVAVVGSMNADYTIVADRLPNPGETVNGSDLRVLP
GGKSGNQAVSAAKIGANVQMFGAVGSDENAEFLLNTLESAGVDTSKILRVEGIKSGATVI
TVDAKAGENTIVYAPGSNAKVSVEYISQEDVKKAISSASVLGLCLESPIETVTEAAKIAR
TAGVKVLLNNSPFVSELPRELIENASILLVNEHEMAQLLKIHEPEDGNWDDFDWFDAARI
MHEYGFDEAVVTLGAEGSVVLDYNAEDGKKAVRICPQKVSAVDTTGCGDAFMGTVLAGLA
AGFSLAQSAQVATYVSAYAATGFGAQSSYGSAQQVVRAFE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaaactactccgttaagcaacgaaaatcttgctaacgcgcttaaaaaaata
ggagaaagtcaaaatcgtgttgctgtagtaggttccatgaacgcagattacacaatagtt
gccgaccgtcttccaaatcctggagaaactgtaaacggaagtgatttgcgagtcctacca
ggaggaaaatctggtaatcaagccgtttctgcagcaaaaatcggcgcgaatgtgcaaatg
tttggtgctgtaggcagcgacgaaaacgcagaattccttcttaacacgctagaatctgca
ggtgtagacacgtctaaaattttacgtgtagaaggcataaaaagtggcgcaacagtaata
acagtagatgcaaaagctggcgaaaacacaatcgtctatgctccaggatccaatgcaaaa
gtaagtgtggaatatattagtcaagaagatgttaagaaggctattagcagtgcaagcgtt
ttaggattgtgccttgaaagcccaatagaaactgtaacggaggctgcaaaaattgcgcgc
acagctggcgtaaaagttttacttaataattcgccttttgtaagcgagctgccacgcgag
ttgattgaaaacgcaagcatactgcttgtaaacgagcatgaaatggcgcaattacttaaa
attcacgagccagaagatggcaattgggatgattttgactggtttgatgcggcgcgcatt
atgcacgagtatggtttcgacgaggcagttgtgactcttggtgcagaaggctctgttgtt
ttagattacaatgcggaagatggtaaaaaggctgttcgcatatgcccgcaaaaagtttct
gcagtagacaccacgggatgcggtgacgcatttatgggaaccgttttggcaggacttgca
gctggatttagtctagctcaaagtgcgcaagtggcaacatatgtttctgcgtacgcagca
acaggatttggagcgcaatcgtcttacggcagcgcgcaacaggtggttcgtgcgtttgag
tag

DBGET integrated database retrieval system