KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0586Help
Entry
HMPREF9231_0586   CDS       T01939                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gvh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(690538..692823)
Genome map
AA seq 761 aa AA seqDB search
MIDNMSTVSNINEDAIAMAVRQDVLAAVSNAEYYNPHEVLGGHLGTGKGAGTATVRVLRP
MAKKVTILTKGGEYEAKHEYNGIFTAVVPATKHSKSKEWSVPSYRIRTVEVDGTESVDDD
PYRYLPQIGDMDMYLFGEGRHERLWEALGAHVKSITDSWGLVSPETGKMVKKVTGTAFTV
WAPNARAVRVVGNFNYWNGRRHAMRSLGSSGIWELFIPGVGAGEVYKFEIMTQAGNWIMK
ADPMERSHELPPNTGSVVVDSEFKWHDSEWLEHRAKTNAHDGPVSIYEVQANSWNRDYDN
YRELADHLVDYVQQEGFTHVEFMPLTQYPFSGSWGYQVTGYYAVDSRLGSPDDFKYLVNK
LHKAGIGVIMDWVPAHFPKDDFALGRFDGTALYEDPDPLRGEHPDWGTYIFNFGRHEVRN
FLVANACFWLSEYHVDALRVDAVSSMLYLDYSREAGQWRPNMYGGRENLEAIDFIKEANA
TAYKNNPGIMMIAEESTAYQGVTAPTDMGGLGFGLKWNMGWMHDTLQYLKEEPINRRWHH
NEITFSMVYAYSEHYVLPLSHDEVVYGKGSLLGKMPGDEWQQFAGLRALLAYQWSHPGKN
LLFMGGEIGQSCEWNFNNSLNWHELQWPFHQGVQKLVADLNALYKSSRAFWSQDFTPDGF
QWLTSDDSDHNTLSYIRIGDNGEEIVVVVNFSGQAWQDYQVALPKGGQWEEVLTTDDAKY
CGSDIHNGTFTAAAEEYHSRPYSARITVPALGAVFLKPVSK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgatagacaacatgagtacagtatctaacatcaatgaagatgcaatcgcaatggctgtc
cgtcaggacgtgcttgctgcggtcagcaacgcagaatactacaatccacacgaggtcctt
ggtggacatctcggaactggcaaaggcgctggtactgccacggttcgcgtattgcgacca
atggccaagaaggtaacaattcttactaagggcggagaatacgaagccaaacacgaatac
aacggtatttttactgctgttgttcctgccacaaagcattctaagagcaaagagtggtct
gttcctagctatcgtatccgcactgtggaagtggatggaaccgagtctgtagatgatgat
ccgtaccgttacttgcctcagattggcgatatggacatgtatctgtttggcgaaggcaga
cacgaaagactttgggaagcactgggtgctcatgttaaaagcattaccgattcttggggt
cttgttagcccagaaacaggaaagatggttaaaaaagttactggaactgcttttacggtg
tgggcgccaaacgcacgcgctgtaagagttgttggcaactttaactattggaatggtcgc
cgccacgcaatgcgttctcttggatctagcggtatttgggagcttttcattccaggagta
ggtgcaggcgaagtttataagtttgagattatgactcaagctggaaactggattatgaag
gcagatcctatggagcgctctcatgagcttccacctaatactggatctgttgttgttgat
tccgaatttaaatggcacgatagcgaatggcttgaacatcgcgcaaagactaatgctcac
gatggtcctgtaagcatctacgaagttcaggcaaatagctggaatcgcgattacgataat
tatcgcgaacttgcagatcacctggttgattacgttcagcaagaaggctttactcacgtt
gagtttatgcctcttacccaatacccgttctcaggttcttggggttatcaggtgactggt
tattacgctgttgactctaggcttggaagcccagacgactttaagtacttagtaaacaag
ctccacaaggctggcattggtgtgattatggattgggttccagcacacttccctaaggat
gactttgctttgggtagattcgacggcaccgcgctttatgaagaccctgatcctcttcgc
ggcgagcacccagattggggaacgtacatatttaactttggcagacacgaggttcgtaac
ttcttggttgctaacgcctgcttctggcttagcgagtatcacgttgatgctttgcgtgta
gacgctgtgtcttctatgctctacttggattacagccgtgaagctggccaatggcgtcca
aacatgtatggcggacgcgaaaaccttgaggctattgactttattaaggaagcaaacgct
actgcatacaagaataatcctggaattatgatgattgcagaagagtccactgcatatcaa
ggcgttactgctcctacagacatgggcggcttaggctttggcttaaagtggaacatgggc
tggatgcacgacactttgcaataccttaaggaagagccaattaatcgccgttggcatcac
aacgaaatcacattctctatggtttacgcatattccgaacattatgtgttgcctttgagt
cacgatgaagttgtgtatggcaagggatctcttcttggaaagatgcctggagacgagtgg
cagcaatttgctggtcttcgtgcgcttttggcatatcagtggtctcacccaggaaagaac
ctcctgtttatgggtggagaaatcggccagtcttgcgaatggaacttcaacaattcgctt
aattggcatgagcttcaatggccgttccatcaaggtgtacaaaagttggtagcagatctt
aacgctttgtataagagttctagagcattttggagccaagactttacgccagacggattc
cagtggcttactagcgacgattctgatcacaatactttaagctacattcgtattggtgat
aacggtgaagaaattgttgtggttgttaacttctctggtcaggcttggcaagattaccaa
gtggcattgcctaagggtggtcaatgggaagaagttcttacaacagacgacgctaagtat
tgtggttctgatattcacaatggcacattcacagccgctgctgaagagtatcattcaaga
ccatattctgcaaggattactgttccagcgcttggagctgtattccttaagccagtcagc
aagtag

DBGET integrated database retrieval system