KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0601Help
Entry
HMPREF9231_0601   CDS       T01939                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
gvh  Gardnerella vaginalis HMP9231
Brite
Enzymes [BR:gvh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     HMPREF9231_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEF31986
Position
706297..707118
Genome map
AA seq 273 aa AA seqDB search
MVDFVESATQIAHNANKNSSHEGIARSVMLVRHGQTPYNAQFRLQGMIDIALDESGIDQV
TRSGKALRVLFGASDLEDPKNPNSQEHVRITPEEADASFVAIVSPLIRAQQTAHAFADKI
GLNVHVENGVRERFFGEWEGLNRQQISEKWPEDFKSWVDGKGGELNHGAETKQEVGDRAA
KAVEDWARKTGSDRDLLVFSHGSCLSQTVHKLLGLDKVDPSYKTIGGMGNGRWARLIPSL
NADGSIHWRLDAYDQGPAADPTSQRLIRIWGAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggtggattttgttgaaagcgcgacgcaaattgcgcataatgcaaataaaaacagctct
cacgagggtattgcgcgttctgtaatgcttgttcgccatggccagacgccttataatgcg
caatttagacttcaaggcatgattgatattgctttagatgagtctggaatagaccaggtg
actcgctctggcaaggctttgcgcgtgctatttggagcttccgacttagaagacccaaag
aatccaaatagccaggagcatgtgcgcattactccagaagaagcagacgcgagttttgtt
gcaattgtttcgccgcttattcgcgctcagcaaacggcgcatgcttttgcagataagatt
ggtcttaatgttcacgttgaaaatggcgtgcgcgagcgcttttttggcgagtgggaaggc
cttaatcgccagcaaattagcgaaaaatggcctgaagattttaagtcatgggttgatggc
aaaggtggtgaactcaaccacggtgcagaaactaagcaagaagttggcgatcgcgcggcg
aaagctgttgaggattgggcgcgcaaaactggctcggatcgcgatttgctagtgttttcg
cacggctcttgcctatctcaaactgttcataagcttcttggattagacaaggtagatcct
tcttataagacgattggtggaatgggaaacggtcgttgggcgcgtttaattccaagtctt
aacgcggatggttcaattcattggcgtttggatgcttacgatcaaggccctgcagccgac
cctacaagtcagcgtcttattcgcatttggggagcagcttaa

DBGET integrated database retrieval system