KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0601Help
Entry
HMPREF9231_0601   CDS       T01939                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9231_0601
   01230 Biosynthesis of amino acids
    HMPREF9231_0601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9231_0601
  Energy metabolism
   00680 Methane metabolism
    HMPREF9231_0601
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9231_0601
Enzymes [BR:gvh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF9231_0601
Exosome [BR:gvh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF9231_0601
  Exosomal proteins of melanoma cells
   HMPREF9231_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
706297..707118
Genome map
AA seq 273 aa AA seqDB search
MVDFVESATQIAHNANKNSSHEGIARSVMLVRHGQTPYNAQFRLQGMIDIALDESGIDQV
TRSGKALRVLFGASDLEDPKNPNSQEHVRITPEEADASFVAIVSPLIRAQQTAHAFADKI
GLNVHVENGVRERFFGEWEGLNRQQISEKWPEDFKSWVDGKGGELNHGAETKQEVGDRAA
KAVEDWARKTGSDRDLLVFSHGSCLSQTVHKLLGLDKVDPSYKTIGGMGNGRWARLIPSL
NADGSIHWRLDAYDQGPAADPTSQRLIRIWGAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggtggattttgttgaaagcgcgacgcaaattgcgcataatgcaaataaaaacagctct
cacgagggtattgcgcgttctgtaatgcttgttcgccatggccagacgccttataatgcg
caatttagacttcaaggcatgattgatattgctttagatgagtctggaatagaccaggtg
actcgctctggcaaggctttgcgcgtgctatttggagcttccgacttagaagacccaaag
aatccaaatagccaggagcatgtgcgcattactccagaagaagcagacgcgagttttgtt
gcaattgtttcgccgcttattcgcgctcagcaaacggcgcatgcttttgcagataagatt
ggtcttaatgttcacgttgaaaatggcgtgcgcgagcgcttttttggcgagtgggaaggc
cttaatcgccagcaaattagcgaaaaatggcctgaagattttaagtcatgggttgatggc
aaaggtggtgaactcaaccacggtgcagaaactaagcaagaagttggcgatcgcgcggcg
aaagctgttgaggattgggcgcgcaaaactggctcggatcgcgatttgctagtgttttcg
cacggctcttgcctatctcaaactgttcataagcttcttggattagacaaggtagatcct
tcttataagacgattggtggaatgggaaacggtcgttgggcgcgtttaattccaagtctt
aacgcggatggttcaattcattggcgtttggatgcttacgatcaaggccctgcagccgac
cctacaagtcagcgtcttattcgcatttggggagcagcttaa

DBGET integrated database retrieval system