KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0704Help
Entry
HMPREF9231_0704   CDS       T01939                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9231_0704 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9231_0704 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF9231_0704 (thrC)
Enzymes [BR:gvh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF9231_0704 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(843167..844684)
Genome map
AA seq 505 aa AA seqDB search
MAENTTNTVMFHSTRSSSKTYTSKQAIRRGIADDGGLFVTDCLGETRYDISNLSGKTYKQ
IAKDVLQILLPDFTSSELDDCVEKAYGSQWEDTEITPLKALGNNNDFVLELFHGPTCAFK
DVALQILPQFISHTKDVSDSNQNVMILTATSGDTGKAALAGFADVEGTSMVTFYPEGKVS
KIQELQMTTQSGDNVKVCAVRGNFDDAQSGVKQIFTNNSINETVENNNHALLSSANSINI
GRLIPQVVYYFYAYSKLVEQGVIELGNEVEFCVPTGNFGNILAGYYAKILGLPVKHLIVA
SNSNNVLFDFLVSGTYNKIRPFNQTIAPSMDILVSSNLERMLYYMCDKDTRLLQMLMNDL
QQWGAFEIPDNVLSKIRKLFGCGWANEDQIRDSIQECWNKHNYVIDPHTACGYFVMNHIP
HDSNVPRVLLSTASPYKFPRVVCESLGLNIEGLDDFACMDLLESKTSTNAPKMLSELKNK
TARFNDVINIEDMPDYVLKCANEIC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaacactacgaatacagttatgtttcacagcactaggtcaagctctaaaacc
tatacctcgaagcaagctattcgtagaggaatagcagatgatggtggattatttgttaca
gattgccttggtgaaactcgttacgatatttctaatctttctggaaaaacttataaacag
attgctaaagatgttcttcaaattctccttccagattttacatctagcgagcttgatgat
tgtgtagagaaggcttatggaagtcagtgggaagatactgaaattactcctttaaaggct
cttggcaataataatgactttgttctagagcttttccacggtcctacctgtgcttttaaa
gatgttgctttgcaaattttgccgcaattcattagtcacacaaaagatgtatctgattct
aatcaaaatgttatgattcttacagccacttcgggagatacaggaaaagctgcgttagct
gggtttgcggatgttgaaggcacttctatggtcactttttacccagaaggtaaagtaagt
aaaattcaagaattgcaaatgaccactcaaagtggagataacgtaaaagtatgtgctgtt
agaggaaattttgacgatgcacaaagcggcgttaaacaaatatttactaacaattcaatt
aatgaaacagttgaaaacaataatcacgcactgctttcttctgctaattcgattaatatt
ggaagacttattcctcaagttgtttactacttctacgcttattctaagcttgttgaacaa
ggcgttattgaacttggtaatgaagtggaattttgtgtccctactggcaattttggaaat
attcttgctggatattacgcgaaaattcttggtcttcctgtaaaacacttaatcgtagcg
agcaacagcaacaatgttttgtttgactttttggtcagtggaacatataacaagattcga
ccatttaaccaaacaattgcaccgtctatggatattcttgtttcttctaatttagaacgc
atgctttactacatgtgcgataaagatacacgactgttgcaaatgctcatgaatgattta
caacaatggggcgcctttgaaataccagataatgttctttctaaaattaggaaacttttt
ggttgcggctgggcaaacgaggatcaaattcgcgattccatacaagaatgctggaataag
cataattatgttattgatccacatactgcttgcggatactttgttatgaatcatattcct
catgattctaatgttccgcgtgttcttttgagcacagcaagcccgtataaattccctagg
gttgtttgcgaatctttaggcctaaatattgaaggattagatgattttgcttgcatggat
ttgttagaaagcaaaacttctacaaacgctcctaaaatgcttagcgaacttaaaaataaa
acagctagattcaacgatgttattaacatcgaagatatgccagattatgttcttaagtgc
gctaacgaaatttgctaa

DBGET integrated database retrieval system