KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0713Help
Entry
HMPREF9231_0713   CDS       T01939                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gvh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851152..851790
Genome map
AA seq 212 aa AA seqDB search
MIGMLSGVIESVDSRCALICVSGVGYEVYMPSSDLAALHEGQDVKVYTSLQVSQDAVTLY
GFTSMPAKRIFLQIQQKVSGVGPKVALSLLSTLNVNRLLQAIADGDITALSSAPGLGKKG
AQKIVLELKGSIDVSQLNEDDTSKDSKSYKKEFDESGISKVVDGLMSLGWKQSDAQRAVE
NVCNSEKIALPISDSDMPNVLRMALAALDRGR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgattggtatgcttagcggcgttattgaatcagttgattctcgatgtgcgcttatctgt
gttagtggtgttggctatgaagtttatatgccatcgtctgatttggctgcgctgcatgaa
ggtcaagatgttaaggtttatacgtctttacaagtaagtcaagatgctgttactttgtat
ggttttacaagtatgcctgccaagcgtatttttcttcaaattcagcagaaagttagtggt
gttggtcctaaagttgctctttctttactttccactttaaatgtgaatcgtttattgcag
gctattgcagatggcgatatcaccgcattgtcttctgctccaggattaggtaaaaagggt
gctcaaaaaattgttcttgaacttaaaggttctattgacgtatctcaattaaatgaagat
gatacttctaaagattcaaaatcttataaaaaggaatttgatgaatctggcatcagcaag
gttgtcgatggacttatgtctttagggtggaagcagtcagatgctcaaagagcggttgaa
aacgtgtgtaatagtgaaaaaattgctctgccaatcagtgattcagatatgcctaatgtt
ttgcgtatggcattggcagcgttagatagaggcaggtga

DBGET integrated database retrieval system