KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0731Help
Entry
HMPREF9231_0731   CDS       T01939                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF9231_0731 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9231_0731 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF9231_0731 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF9231_0731 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF9231_0731 (adhP)
   00626 Naphthalene degradation
    HMPREF9231_0731 (adhP)
Enzymes [BR:gvh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF9231_0731 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(871157..872167)
Genome map
AA seq 336 aa AA seqDB search
MKAIVATKDKKAQVVEKELRPLEFGEALLDMECCGVCHTDLHVKNQDFGDKTGVVLGHEG
IGIVKEVGPGVTTLKPGDRASVAWFFKGCGHCEYCTTGRETLCRSVLNAGYTADGGMSQE
CIVAADYAVKVPEGLDPAPASSITCAGVTTYKAIKESGVHPGEWLILFGLGGLGNLALQY
AKNVFGAHVIAVDVNDAQLEFAKEYGADLCVNPLKENVPEFAMKKVGGAHGAVVTAVSKA
AFNSAVDSVRAGGTVAAVGLPPEDMELSIPRLVLDGIRLVGSLVGTRKDLEEAFQFGAEG
KVVPQCHMRKMEDINDIFDEMLSGKIRGRMVIDLSH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctattgttgcaaccaaagataagaaggctcaggttgtagagaaggaactccgc
ccattggaatttggtgaggccttactcgatatggagtgctgcggcgtatgccacaccgat
cttcacgttaagaaccaagattttggcgataaaacaggcgtggttcttggacacgaaggt
attggtattgttaaggaagttggccctggtgttacaacattaaagccaggcgaccgtgca
tctgtagcatggttcttcaagggttgcggacattgcgaatattgcaccacgggcagagaa
acactttgccgtagcgttttgaacgcaggatacactgcagatggtggcatgtctcaagag
tgcatcgtcgcagcagactacgcagtaaaggtcccagaaggcttggatccagctcctgca
agctccatcacttgcgctggtgttacaacctacaaggctattaaggaatctggcgtacat
ccaggcgaatggcttattttattcggtcttggcggtcttggtaatcttgcgttgcaatat
gcaaagaacgtatttggtgcgcacgtaatcgcagtagatgttaacgatgctcagcttgaa
tttgctaaggaatatggcgcagatttgtgcgtgaacccacttaaggaaaatgttcctgaa
tttgctatgaagaaggtaggcggcgctcatggcgctgtcgtaaccgctgtaagcaaggct
gcttttaacagcgcagttgactctgtgcgagcaggcggcactgttgcagccgttggtctt
ccaccagaagacatggaacttagcattcctcgccttgttcttgacggaatccgtttggtt
ggatcccttgttggaactcgtaaggatttggaagaagcgttccagtttggtgctgaaggc
aaagttgttccacagtgccatatgcgcaagatggaagacattaacgacatcttcgacgag
atgctcagcggtaagattcgtggtcgaatggtaatcgacctctcccactga

DBGET integrated database retrieval system