KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0746Help
Entry
HMPREF9231_0746   CDS       T01939                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF9231_0746
   00052 Galactose metabolism
    HMPREF9231_0746
   00500 Starch and sucrose metabolism
    HMPREF9231_0746
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9231_0746
Enzymes [BR:gvh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF9231_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892461..893888
Genome map
AA seq 475 aa AA seqDB search
MGDTFELSAAKMREQGMSEIAINQFAHLYDSWINDKSGEFIRENTVEPIKSVPNFHEIYE
TIDHDKAVNAFAKTAFIKLNGGLGTSMGLSCAKSLLPVRRHKARQMRFIDIIIGQVLTAR
QRLGVDLPLIFMNSFRTSKDTLQVLKRNRKFSQENIPVEIIQHQEPKLLEETCEPVSYPE
DPELEWCPPGHGDIFSTIWESGLLNVLKKNGIEYLFISNSDNLGARPSRTLAQHFENTGA
SIMIEVAKRTQADRKGGHIVRDLETGRMMLREMTQVHPEDRRSAQSIKKHPYFNTNNIWV
RVDALQKKLEEYNGVLPLPVICNRKTIDPTNEKSEKVIQLETAMGAAISLFNDAICVEVD
RMRFLPVKTTNDLFIMRSDRFHLTDSYEMEDGNYIFPDIDLDPRYYRNINDFNERFPYSV
PALAAAKSVTIRGDWTFGNQVSMFSDAVLEDTGEPSYVPNGEFVGPQGIEPDEWV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacttttgaattgtccgctgcaaagatgcgcgaacaaggtatgagtgagatt
gcgattaatcaatttgcgcatctttatgactcgtggattaatgataagtctggtgaattt
attcgcgaaaacactgtagagcctattaagagtgttccaaattttcacgaaatttatgag
actattgatcatgataaagctgtaaacgcttttgcaaaaacagcgtttattaagcttaat
ggtggtttgggaacgtctatgggattgtcgtgcgcaaaatctttgttgcctgtccgtagg
cacaaagctcgacaaatgcgatttatagatataataatcggtcaggttcttacagcacgc
caacgcttaggtgttgatttacctcttatttttatgaactctttccgcacatctaaagat
acattacaagtgctgaagcgtaatcgtaaattttctcaagaaaacattcctgttgaaatt
attcagcatcaagaaccgaaattgctagaggaaacctgtgagccagtttcttatccagaa
gatcctgagttagagtggtgtcctccaggtcatggagatattttctctacaatttgggaa
tcaggattgttaaacgttttgaagaaaaatggtattgaatatttatttatttcaaattca
gataatttaggcgctagaccttctcgtactcttgctcagcactttgaaaacacgggtgct
tcaataatgattgaggttgctaagcgtactcaagccgatcgtaaaggtggtcatattgtt
agagatctcgaaactggaagaatgatgcttcgagaaatgactcaagttcatccagaagat
cgaagaagtgctcaaagtattaagaaacatccctattttaatacaaataatatttgggtt
cgcgttgacgcattacaaaaaaagttggaagaatacaatggagttcttcctcttcctgtg
atttgcaatagaaaaactattgatcctacaaatgaaaaaagcgagaaagttattcagctg
gaaactgcgatgggtgctgcaatttcgctttttaatgatgctatttgtgtagaagtagat
agaatgagattcttgcctgtcaagacaactaatgatttgtttataatgcgttcagacaga
ttccatcttactgattcttatgagatggaggatggcaactacatattcccagatattgat
ctcgatcctcgttattatcgaaatatcaatgatttcaacgaaagattcccttattcggtg
cctgctttagctgctgcaaagtcagttactattcgtggtgattggacatttggtaatcag
gtttctatgttctccgatgctgttttagaagatactggagagccaagctacgttccaaat
ggggaatttgttgggcctcagggtattgaaccagatgaatgggtgtaa

DBGET integrated database retrieval system