KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0795Help
Entry
HMPREF9231_0795   CDS       T01939                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
gvh00010  Glycolysis / Gluconeogenesis
gvh00051  Fructose and mannose metabolism
gvh00562  Inositol phosphate metabolism
gvh01100  Metabolic pathways
gvh01110  Biosynthesis of secondary metabolites
gvh01120  Microbial metabolism in diverse environments
gvh01130  Biosynthesis of antibiotics
gvh01200  Carbon metabolism
gvh01230  Biosynthesis of amino acids
Module
gvh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9231_0795 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF9231_0795 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF9231_0795 (tpiA)
Enzymes [BR:gvh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF9231_0795 (tpiA)
Exosome [BR:gvh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF9231_0795 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF9231_0795 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF9231_0795 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA_26
Motif
Other DBs
NCBI-ProteinID: AEF31939
Position
complement(948605..949402)
Genome map
AA seq 265 aa AA seqDB search
MVVNRKPLVAGNWKMNFNHLEATHFIQKFWWRLCDSHFDCKKCDIALMPSFTSLRSVQVL
VESDNLPILYGAQAVSVTAQGAFTGDVSADMLASLGCSMVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERKQGIELDFAVGQVHDVTRDLDSKQAERLIIAYEPVWA
IGTGMVATAQSAQDAAKAIRDDLQETFGDTVSQKVRILYGGSVTSSNAASLICEPDVDGF
LIGGASLDIEELATIVQLSSYKNRI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcaataggaaaccgctagttgcaggcaattggaagatgaattttaatcacctc
gaagccactcattttattcaaaaattctggtggcgtctatgtgattctcacttcgattgt
aaaaaatgcgatattgctcttatgccatcgtttacgtccttgagaagtgtgcaagtatta
gttgagtctgataatcttcctattctttatggcgcgcaagcagtttccgttacagctcaa
ggcgcgtttactggagatgtttctgcagatatgcttgcaagcttgggctgctcaatggtg
attgtaggtcattctgagcgacgcaagtatcatccagaagatgatgcgaatattgttgac
caagtgcgagctgtgcttgctgctggaatgcaacctattctttgcgttggtgaaagtttt
gaagagcgcaagcagggtatagagcttgattttgcagttggacaggttcacgatgttact
cgcgatttggattctaagcaggcagagcgtttgattattgcctacgaaccagtttgggct
attggaactggaatggtcgctacagcgcagtctgctcaagatgctgctaaggctattagg
gatgatctgcaggaaactttcggggatactgtatcacagaaagttagaatactttatggc
ggctctgtaacgtcttctaatgcagcaagtcttatttgtgagccagacgttgatggattt
cttattggtggagcttctttagacattgaggaattggctactattgttcaattgtcgtct
tacaaaaatcgaatttaa

DBGET integrated database retrieval system