KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0795Help
Entry
HMPREF9231_0795   CDS       T01939                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9231_0795 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF9231_0795 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9231_0795 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF9231_0795 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF9231_0795 (tpiA)
Enzymes [BR:gvh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF9231_0795 (tpiA)
Exosome [BR:gvh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF9231_0795 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF9231_0795 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF9231_0795 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(948605..949402)
Genome map
AA seq 265 aa AA seqDB search
MVVNRKPLVAGNWKMNFNHLEATHFIQKFWWRLCDSHFDCKKCDIALMPSFTSLRSVQVL
VESDNLPILYGAQAVSVTAQGAFTGDVSADMLASLGCSMVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERKQGIELDFAVGQVHDVTRDLDSKQAERLIIAYEPVWA
IGTGMVATAQSAQDAAKAIRDDLQETFGDTVSQKVRILYGGSVTSSNAASLICEPDVDGF
LIGGASLDIEELATIVQLSSYKNRI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcaataggaaaccgctagttgcaggcaattggaagatgaattttaatcacctc
gaagccactcattttattcaaaaattctggtggcgtctatgtgattctcacttcgattgt
aaaaaatgcgatattgctcttatgccatcgtttacgtccttgagaagtgtgcaagtatta
gttgagtctgataatcttcctattctttatggcgcgcaagcagtttccgttacagctcaa
ggcgcgtttactggagatgtttctgcagatatgcttgcaagcttgggctgctcaatggtg
attgtaggtcattctgagcgacgcaagtatcatccagaagatgatgcgaatattgttgac
caagtgcgagctgtgcttgctgctggaatgcaacctattctttgcgttggtgaaagtttt
gaagagcgcaagcagggtatagagcttgattttgcagttggacaggttcacgatgttact
cgcgatttggattctaagcaggcagagcgtttgattattgcctacgaaccagtttgggct
attggaactggaatggtcgctacagcgcagtctgctcaagatgctgctaaggctattagg
gatgatctgcaggaaactttcggggatactgtatcacagaaagttagaatactttatggc
ggctctgtaacgtcttctaatgcagcaagtcttatttgtgagccagacgttgatggattt
cttattggtggagcttctttagacattgaggaattggctactattgttcaattgtcgtct
tacaaaaatcgaatttaa

DBGET integrated database retrieval system