KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1007Help
Entry
HMPREF9231_1007   CDS       T01939                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gvh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gvh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210038..1210670)
Genome map
AA seq 210 aa AA seqDB search
MANDIPVRLIWGQAYDLEGRVGAMGVNGGMPWRLSTDLRYFKAMTISCPVIMGRGTWDSM
PEKFRPLPGRENIVVSRNPDFNSDGAKSFTSIEEAICYAKKWIEDNPIEHVDSSDLPKDG
SAVWIIGGGAIFREVIESQIVDAAYVTQIDTRVEADTFAPNIQKLVDDGLWKVARDCDWQ
ESTIKVGANQFNTKYKFMVYEPVKSKNKLD
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgatattcctgtgcgtttaatttgggggcaagcatacgatttggaaggccgc
gtaggcgcaatgggtgtaaatggtggtatgccatggagactttccacagatttgcgctat
tttaaagccatgacaatttcttgcccagtaataatgggtaggggaacttgggattctatg
ccagaaaagttccgtcctcttcctgggcgagaaaatatcgttgtttctaggaatccagat
tttaattcagatggtgcaaaaagttttacaagcattgaagaagcaatatgttacgcaaaa
aaatggattgaagataatcctattgagcatgtagattcttcagatttgcctaaagatggt
agcgcagtttggattattggtggcggagcaatttttagagaagtgattgagtcgcaaatt
gttgacgctgcctatgtaactcaaattgacactagagtagaagctgatacgtttgctcct
aacattcagaaacttgtagatgatggattgtggaaagttgcacgtgattgtgattggcag
gaatcgactataaaagttggcgcaaatcaattcaatacaaaatataagtttatggtttat
gagccagttaaatctaaaaataagctagattaa

DBGET integrated database retrieval system