KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1112Help
Entry
HMPREF9231_1112   CDS       T01939                                 

Definition
(RefSeq) hypothetical protein
Organism
gvh  Gardnerella vaginalis HMP9231
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1348596..1349657)
Genome map
AA seq 353 aa AA seqDB search
MDTIKLSGIKPSDTDAFIGLYTRLSVDAVLSLDLRAAVAGDSTQTVDIAQISKRISRVLD
SCVQDDDIAKNSSICLELTAGRLLDSAMKSWLVKQAEITVNAQFKADFNDASYDLPNADG
VSITIRRVADDVETSQIFGLANPTDASPFAAEQKEKLQDETSRDESKDKSQATSDSNSSL
DSVYSQSGYNPIITTAVVSMQGEKSESTKFAMLDVITSLEQSKEPISTQLDGVSALYQVS
SDKGEEYSAIIVVSSTMVEDDLALKIKEMQISQEQNLRLRILGTRQYGSDSSNTKTMDSD
RLDSQLNAAQLEPWMQIEPDASIDGEPLAYKLAFAPDAARVGIYSERWIMGEC
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacacaattaagttaagtggtattaaaccgagtgatactgatgcttttattggctta
tatactcgccttagtgttgacgctgttttgagtttagatttgagggcagcggttgctggc
gactctacccaaacggttgatattgcccagatttctaaaaggattagccgcgttttggac
tcgtgtgttcaagatgatgatattgctaagaattcttcgatctgtttggagcttacggct
ggaaggctactggattcagctatgaaatcttggcttgttaaacaggcagagattactgtt
aatgcgcagtttaaagctgattttaacgatgcttcttatgatttacctaatgcagatggc
gtgtctattacgattcgtagggttgcagacgatgtggaaacatcgcagatttttggattg
gcgaatcctacagatgcgtcgccttttgcggctgagcagaaggaaaaattacaagatgag
acttcgagagatgagtctaaagataagtcgcaagcaaccagcgattctaattcttcttta
gattctgtctatagccaatctggctataatccaattatcacaactgcagtagtgtcaatg
cagggagaaaaatcagagtcaacaaaattcgccatgctagatgtaatcacgagtttggag
caatcgaaagaacctatttcaactcaattagacggcgtttcggcgttatatcaggtaagc
tctgataaaggcgaagaatattctgcaataatagtggtatctagtacaatggtagaagat
gatttagcgcttaagatcaaagaaatgcaaatttctcaagaacaaaatttgcgattgaga
attttaggcacgaggcaatacggatctgatagttcaaacacaaagactatggattcagat
aggcttgattcacagctaaatgctgcacaattggagccatggatgcaaattgagccagat
gcttcaattgacggagaaccacttgcgtacaaacttgcgtttgcaccagatgcagcgcga
gtcggtatttattcagaacgttggattatgggagagtgttga

DBGET integrated database retrieval system