KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1112Help
Entry
HMPREF9231_1112   CDS       T01939                                 

Definition
hypothetical protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF9231_1112
Enzymes [BR:gvh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HMPREF9231_1112
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     HMPREF9231_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1348596..1349657)
Genome map
AA seq 353 aa AA seqDB search
MDTIKLSGIKPSDTDAFIGLYTRLSVDAVLSLDLRAAVAGDSTQTVDIAQISKRISRVLD
SCVQDDDIAKNSSICLELTAGRLLDSAMKSWLVKQAEITVNAQFKADFNDASYDLPNADG
VSITIRRVADDVETSQIFGLANPTDASPFAAEQKEKLQDETSRDESKDKSQATSDSNSSL
DSVYSQSGYNPIITTAVVSMQGEKSESTKFAMLDVITSLEQSKEPISTQLDGVSALYQVS
SDKGEEYSAIIVVSSTMVEDDLALKIKEMQISQEQNLRLRILGTRQYGSDSSNTKTMDSD
RLDSQLNAAQLEPWMQIEPDASIDGEPLAYKLAFAPDAARVGIYSERWIMGEC
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacacaattaagttaagtggtattaaaccgagtgatactgatgcttttattggctta
tatactcgccttagtgttgacgctgttttgagtttagatttgagggcagcggttgctggc
gactctacccaaacggttgatattgcccagatttctaaaaggattagccgcgttttggac
tcgtgtgttcaagatgatgatattgctaagaattcttcgatctgtttggagcttacggct
ggaaggctactggattcagctatgaaatcttggcttgttaaacaggcagagattactgtt
aatgcgcagtttaaagctgattttaacgatgcttcttatgatttacctaatgcagatggc
gtgtctattacgattcgtagggttgcagacgatgtggaaacatcgcagatttttggattg
gcgaatcctacagatgcgtcgccttttgcggctgagcagaaggaaaaattacaagatgag
acttcgagagatgagtctaaagataagtcgcaagcaaccagcgattctaattcttcttta
gattctgtctatagccaatctggctataatccaattatcacaactgcagtagtgtcaatg
cagggagaaaaatcagagtcaacaaaattcgccatgctagatgtaatcacgagtttggag
caatcgaaagaacctatttcaactcaattagacggcgtttcggcgttatatcaggtaagc
tctgataaaggcgaagaatattctgcaataatagtggtatctagtacaatggtagaagat
gatttagcgcttaagatcaaagaaatgcaaatttctcaagaacaaaatttgcgattgaga
attttaggcacgaggcaatacggatctgatagttcaaacacaaagactatggattcagat
aggcttgattcacagctaaatgctgcacaattggagccatggatgcaaattgagccagat
gcttcaattgacggagaaccacttgcgtacaaacttgcgtttgcaccagatgcagcgcga
gtcggtatttattcagaacgttggattatgggagagtgttga

DBGET integrated database retrieval system