KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1225Help
Entry
HMPREF9231_1225   CDS       T01939                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9231_1225 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF9231_1225 (murA)
Enzymes [BR:gvh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF9231_1225 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1485613..1486971)
Genome map
AA seq 452 aa AA seqDB search
MSAHNTAEQNESGIDAADVLHVEGGKPLNGAIKVRGAKNFVSKAMVAALLAPGKSVLKNV
PEIRDVHVVSDLLRLHGVNVDVDGAAGVVSIDASNVQLADVADVDTLSGSSRIPILFSGP
LLHRLGEAFIPALGGCNIGGRPIDFHLETLRKLGANVDKDHEDGIHITAPNGLHGTKIHL
PYPSVGATEQTLLAAVLAEGKTELSGAAIEPEIMDLVAVLQKMGAIISVDVDRTFRIEGV
DKLQGYNHTALTDRIEAASWASAALATHGDVFIKGATQPEMMTFLNVFRKVGGQFDVTDN
GIRFWHPGGDLHPVAIETDVHPGFMTDWQQPLVVALTQAKGLSIVHETVYENRFGFTKPL
VQMGAMIQLYRECLGSLPCRFQQRNYKHSAVIFGPTPLTGQDIDVPDLRGGFSHLIAALA
AKGPSNVKGISLIDRGYADFRGKLTALGADID
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgcgcataatacggctgaacagaacgaaagtggcattgacgctgcagacgttttg
catgtagaaggtggcaagccgcttaacggagctattaaagttcgtggtgcaaaaaacttt
gttagtaaagcaatggttgcagctttgcttgctcctgggaaatccgtgttaaagaatgtt
ccagaaatcagagatgttcacgttgtttctgatttgctgcgtttgcatggagtaaacgta
gatgttgatggcgctgcaggcgttgttagtattgacgcaagcaacgttcagcttgctgat
gttgcagacgtagatacattatcaggatcttcgagaatacctattctcttctctggtccg
cttcttcacagacttggtgaggcttttatcccagctttaggtgggtgcaatattggaggg
cgtccaatagatttccatcttgaaactttgcgtaaacttggtgcgaatgtagataaagat
catgaggatggtattcatattactgctcctaacggcttgcatggcactaaaattcatcta
ccttatccatcggttggtgccactgagcaaactcttcttgcagccgtgcttgcagaaggt
aaaacagagctttcgggtgctgcaattgagccagaaattatggatttggtggctgttttg
cagaaaatgggcgctattatttctgttgacgttgatcgcacatttaggattgagggtgtt
gataagcttcaaggctacaatcatacggctttaacagataggattgaggcagcatcttgg
gcttcggcggcgctcgcaactcatggtgacgtgtttattaaaggggctactcagccagag
atgatgaccttcttaaacgtgttccgtaaagttggtggtcagtttgacgttacggataac
ggtattcgcttctggcatccgggtggtgatttgcatcctgttgctattgaaaccgatgtt
catcctggttttatgactgattggcagcagcctcttgttgttgctttaacgcaggctaaa
ggtttgagtattgttcacgaaactgtttatgaaaatcgttttggctttacaaaaccgctt
gttcaaatgggcgctatgattcagttgtatcgcgagtgcttaggttctcttccttgccga
ttccagcagcgaaattacaagcattctgctgtgatttttggtccgacgcctcttactggt
caagatattgatgttcctgatttgcgaggcggttttagtcatcttattgcggctcttgca
gctaagggtccatctaacgttaagggtatttcgcttattgaccgcggttatgcagatttc
cgcggtaagttgactgctcttggcgcggatattgattga

DBGET integrated database retrieval system