KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1325Help
Entry
HMPREF9231_1325   CDS       T01939                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF9231_1325 (recR)
DNA repair and recombination proteins [BR:gvh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HMPREF9231_1325 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1624043..1624651)
Genome map
AA seq 202 aa AA seqDB search
MHNVSSYDGAIGRVIDAFSKLPGIGPKGAQRIAFYILSSSDVQTQDLIDAISDLRENVRF
CEICGNVCEQSPCVICQDPRRDHTKICVVEEPKDIMSIERTHEYAGVYHVLGGAINPMAN
IGPADLKITQLLERLKDAQVKEVILALDPNIEGEATVTYLARLLEPLDISITRLASGLPV
GGDLEYADEITLGRAFAGRQEV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcataacgtgtcatcgtatgacggtgcaataggcagagttattgatgcgttctctaag
cttccaggaataggaccaaaaggcgcgcagcgaattgcattctatatactttcatcatct
gatgtacaaacgcaggatttaattgacgcaatcagtgacttgcgcgagaatgtgcgattt
tgtgaaatttgcggaaatgtttgcgagcaaagcccttgtgttatttgccaagatccgcga
agagatcacacaaaaatatgcgttgtagaagagccaaaagacattatgagcattgagaga
actcacgaatacgctggcgtttaccacgttttgggcggtgccattaatccaatggcaaac
attggacctgcagacttaaaaataacgcaactacttgagcgcttaaaagacgcgcaagta
aaagaagtcattttggcgcttgacccaaatattgaaggagaagctacagtaacttattta
gcacgtttgcttgagccgcttgacataagtattacgcgacttgcaagcggattgccagtt
ggtggagacttagagtatgcagacgagataactcttggtcgcgcatttgcaggaagacaa
gaagtatag

DBGET integrated database retrieval system