KEGG   Gloeobacter violaceus: gll0102Help
Entry
gll0102           CDS       T00148                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gvi  Gloeobacter violaceus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    gll0102
Enzymes [BR:gvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     gll0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(102033..102941)
Genome map
AA seq 302 aa AA seqDB search
MKTVRLRAAAKINLYLEILGVRPDNFHELVMVLQSVDLADTVTLRAAPTTRVSCSHPLVP
NDRTNLAVRAVEVLQKHTGIDEGVEIVIEKRIPVASGLAGGSTDAAAVLAGLNVLWDLGL
TQRQLQSLGAQIGSDIPFCVTGGTALAMGRGEVLSPLPALKGVYLVLAKLADLQVSTAWA
YQTYRREYLSEGTAPRARTSALLSAVASQEVARIAPLLHNDLERAVLPAYPQVSALREHL
VSAGALGAMMSGSGPAVFGLARDRAHAEAVCAVLAGEPGLELFVCKTQQAGILMEESESS
DL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgttcgcctgcgggccgccgccaagatcaatctctacctcgagatactcggg
gtacgccccgacaacttccacgaattggtgatggtgctgcagagcgttgatctggccgac
accgtcaccctgcgcgccgcgcccacgaccagggtgagttgctcccatccattggtgccc
aacgaccgtaccaatctggcggtaagagcggtcgaagtgcttcagaagcacaccggcatc
gacgaaggagtcgagattgtcatcgagaagcgcatcccggtagcgagcggtctggcgggc
ggctccaccgacgccgccgcagtgctggcggggctcaacgtgctttgggatctcggcttg
acccagagacagctgcagtctctgggtgctcaaatcggctcggatattcccttttgtgtg
acaggcggcaccgcccttgctatgggccggggtgaagtgctctcgcctctgccggccctg
aagggggtctacttagtgctggccaaactcgccgatttgcaggtatccaccgcctgggcc
taccagacctaccggcgcgagtatctgagcgagggtaccgcgccgcgcgcccgcaccagt
gctctgctctcggcggtggccagccaggaggttgcccgcatcgcaccactgttgcacaac
gacctggagcgcgccgtgctgcccgcctacccgcaggtgagcgcgctgcgcgaacacttg
gtgagcgccggggcactgggggcaatgatgtctggctccggcccggcggtgtttggcctt
gcaagggaccgcgcccacgccgaggctgtttgtgccgtccttgcgggtgaacccggactg
gaactgttcgtctgcaaaacccagcaggcgggcatcctgatggaagaatcggagtcctcc
gacttgtaa

DBGET integrated database retrieval system