KEGG   Gloeobacter violaceus: gll1169Help
Entry
gll1169           CDS       T00148                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gll1169
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gll1169
   00052 Galactose metabolism
    gll1169
   00500 Starch and sucrose metabolism
    gll1169
   00520 Amino sugar and nucleotide sugar metabolism
    gll1169
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    gll1169
   00524 Butirosin and neomycin biosynthesis
    gll1169
Enzymes [BR:gvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     gll1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(1246050..1247033)
Genome map
AA seq 327 aa AA seqDB search
MILAGDVGGTNTRLAGFEPVAGNLMPIVSETYASRDYSSLDQIVYLFISEYHLRVAAACF
GVAGPVRRGRAETTNLPWSIDASTLAAGLKLPTVGLINDLEANAHGIALLGPADFAVLNP
GAADAMGNQAVIAAGTGLGEAGLFWDGRRHRPFATEGGHTDFAPGDALQIELLHHLRVRF
AHVSWERVLSGPGLVNIYQFLRDTRRGEEPNWLTEELRNHPNPAAVISQVALAGKSWLCE
QALDLLIVLYGAEAGNLALKVAALGGVFLGGGIAPKLVERLKGPAFLEAFLAKGRLRPLL
EAMPVRVILNDRAALLGAAHCAMQTLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgcgggtgatgtgggcggaaccaacacgcggctggccggcttcgagccggtc
gcgggcaacttgatgccgatcgtctccgagacctatgccagccgggattactccagtctc
gaccaaatcgtctatctttttatttctgagtaccatctgcgggtcgccgccgcctgcttc
ggggtggcggggccggtcaggcggggccgggccgagacgaccaacctgccctggtcgatc
gacgcctccaccctggctgccgggctcaagctgccgacggtgggactgattaacgatctg
gaggccaacgcccacggcattgcgctgctgggaccggcggattttgccgtactcaacccg
ggcgcggcggatgcgatgggcaaccaggcggtgatcgccgccggaacggggcttggggag
gcgggtttgttttgggatggcaggcggcatcggccctttgccaccgagggcggccacacc
gattttgcgcccggcgacgcgctgcagatcgagttgctgcaccatctgcgggtgcgcttt
gcccatgtgagctgggagcgggtgctctccggtccgggactggtgaatatctatcaattt
ctgcgggacacccggcgcggggaggaacccaactggctcaccgaggagcttcgcaaccat
cccaacccggcggcggtcatctcgcaggtggcgctcgcgggcaagtcctggttgtgcgaa
caggccctcgatttgctgattgtcctgtacggtgcagaggcgggcaatctcgccctgaag
gtcgccgccctaggcggggtgtttttggggggcggcatcgcccccaaactggtggagcgg
ctcaaaggaccggcatttttggaggcgtttcttgccaaggggcgtctgcgcccgctttta
gaggcgatgccggtgcgcgtcatcctcaacgatcgggccgccctgcttggagcggcccac
tgcgccatgcaaactttgatctag

DBGET integrated database retrieval system