KEGG   Gloeobacter violaceus: gll1431Help
Entry
gll1431           CDS       T00148                                 

Definition
(RefSeq) alpha-glucanotransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00500  Starch and sucrose metabolism
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    gll1431
Enzymes [BR:gvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     gll1431
Exosome [BR:gvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   gll1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 AMPK1_CBM DUF3459 Alpha-amylase_C TTC5_OB
Motif
Other DBs
NCBI-GeneID: 2598700
NCBI-ProteinID: NP_924377
CYORF: gll1431
UniProt: Q7NKP6
Position
complement(1535661..1537394)
Genome map
AA seq 577 aa AA seqDB search
MSSVCNGEIMTTTKDPSESKVQPQSEAKADAKTGMIRFQLLAPYNEKAALVGSFSNWEEI
PMEKDDKGCFFVEIDLPDGEHQYKFKLVSKSFFCEGETVAIADPYARQVDEKNRENTVIR
IKDGKQITDEYVWEHDDVPLSPDDHLIIYELHVSAFGGDTFIDAIQQLDYLVDLGVNCVQ
LMPVTEYPGEHYWGYNPRHPFAPESSYGKPEDLKAFVDACHERGFRVILDIVLNHSESES
PLTRIDFTYWFYAPGTEPDEPGNVWGPKFNLEFYDEHYKRNPAREYLYDLVDYWVREYHI
DGYRIDAAAQIKYFDFLGEVARRSKANSGGKPFYLVGEHIPENPAITGADGPMDGAYHET
YYWMIDDLMVRNMFDTDQIVDSINPLHHGYPGPSNAVNFYENHDKPRLLQRLRDAGINEE
GSFKRLECAAALLMTSVGLPMLYQGQAMGQAYPQDEEVHAVEWTLLDHDRHVALLERYKG
LIDLRRETQALWTNEIDFFHIDQEARVIAYVRFNAEGSRVAVVAHLGDGNLGDYQVPCFP
EDGHWFEKTRLYEVDVEGGILNVHLSDWDVHVFRNGG
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggtctgcaatggggagattatgacgacgaccaaagatccgtccgagagcaag
gtgcagccgcagtccgaagcaaaagccgatgcgaagaccggcatgattcgctttcaactg
ctggccccctacaacgaaaaagcggcactcgtaggctcattctcgaactgggaagagatc
ccaatggagaaggacgacaagggctgctttttcgtcgagatcgatttaccggatggtgaa
catcagtacaagttcaagctcgtttccaagagtttcttctgcgagggcgagacggtggcg
atcgccgacccgtatgcccgccaagtcgatgagaaaaaccgcgaaaataccgtcatccgc
atcaaagacggcaagcaaatcaccgacgagtatgtctgggagcacgacgatgtgcccctt
tccccggacgaccatttgatcatctatgaactgcacgtgagcgcctttggcggcgacacg
ttcatcgatgcgatccaacagctcgactacctggtggatctgggggtcaactgcgtgcag
ttgatgcccgtcaccgagtacccgggcgagcactactggggttacaacccccgccatccc
tttgcccccgaatcctcctacggcaagcccgaagatctcaaagccttcgtggacgcctgt
cacgagcgcggttttcgggtcatcctggacattgtcctcaaccactccgaatcggaaagc
ccgctcacgcgcatcgactttacctactggttctatgcgccgggcaccgagccggacgaa
ccgggcaatgtctggggacccaagttcaacctcgaattttacgacgagcactacaagcgc
aacccggcccgcgaatacctctacgatctggtcgattactgggtgcgcgagtaccacatc
gacggctaccgcatcgacgccgccgcccaaattaaatacttcgattttctgggcgaagtg
gccaggcgttcgaaggccaattcggggggcaaacccttctacctcgtcggcgagcatatc
cccgaaaacccggcgattaccggtgcggacggcccgatggacggcgcctaccacgagact
tactactggatgatcgatgatctgatggtgcgcaacatgttcgacaccgaccagattgtc
gactcgatcaaccccctgcaccacggctatccggggccgagcaacgccgtcaacttctac
gaaaaccacgacaagccccgcctgctgcagcggctgcgcgacgcgggcatcaacgaagag
ggcagcttcaagcgcctggagtgcgcggcggccttgctgatgacctcggtgggtctgccg
atgctctaccagggccaggcgatgggccaggcctatccccaggacgaggaagtgcacgcg
gtggagtggacactgctcgatcacgaccggcacgtggcgcttctggagcgctacaaaggt
ctcatcgacctgcggcgcgagacccaggcgctctggaccaacgagatcgattttttccac
atcgaccaagaagcgcgggtgatcgcctacgtgcgcttcaacgccgagggctcgcgggtg
gcggtcgtcgcccacctgggcgacggcaacctgggcgattaccaggtgccctgcttcccc
gaggacggccactggttcgagaagacccgcctctacgaagtcgacgtcgaaggcggcatc
ctcaacgtgcacttgagcgattgggacgtgcatgtcttccgcaacggcggctga

DBGET integrated database retrieval system