KEGG   Gloeobacter violaceus: gll1854Help
Entry
gll1854           CDS       T00148                                 

Definition
two-component sensor histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
gvi  Gloeobacter violaceus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gvi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gvi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(1972641..1976366)
Genome map
AA seq 1241 aa AA seqDB search
MAIDSGGGADSFSLSLGSFAIVAVGASAGGLEAFTQFLGALPTDTGMAFVLIQHLKADQP
SLLVEILDKTTGMDVVQVHNGTVVEPNHVYVIPPDRQMAITSGVLTLSQRRKTDGQFMPI
DSFFHSLAADWGNRAIGVVLSGADGDGAQGLKAIKAAGGLAFAQDEQSARFPSMPHNAAA
TGLLDFVLPPREIAVRLAAVGRHPYIAPPAATAPPTPPGAEEARSAAIALLRAATGVDFG
QYKRPTFERRLQRRMALHQIESPQEFVRHLQDHPEEVQALYRDVLISVTGFFRDPEAFEA
VKNTVLSAITQQRAEGLPIRVWVPGCATGEEVYSLAIGVLEFLEEHPSPTPVQFFGTDIS
EEAIALARTGLYHASQIEGLSPERLRRFFSQGEGGHRVCKRVRELCVFARHDLLADPPFS
QMDLVSCRNVLIYFSLPAQKRVLTTFHYSLKPDGFLLLGTSESPGGASELFNRVDSKNKL
FSRKAVPARLLLEYAAGPVAADPLNPKQPAAGGAGNAPDLQKEADRLVLDRYAPVGVVVG
ADAEVLHFRGQTGPYLQPSPGRASLNLLKMVHPGLRSQLRSALQLAAKQSLAQCQQDIRL
YDGDRERRVRIDVAPFRSASGQTHFLVLFADTPMVEVSAPLPGPRSAAADRQSAQQQRLL
ELQQELTAKEEYLRTAIEESEAVNQNLRVANEEILSSNEELQSTNEELQTAKEEIQSTNE
ELHTINDELQRRNRELDRLGNDLQNLLASTRLPIVMLDSELRIRRFTPQAGELLHFVSAD
VGRPVRDINHRLSVPDLPERVLEVIASRRIHIQEVQDRGGHWHELCIRPYHTLDGATEGA
VLVLVDIDQSKRAVEEVKAARDYAEAIVETVGEPLIVLDAELSAVTANRAFYELFETHPD
QIEGRSLFEVSGGQWNLPQLREALEGVLQGDGRVQDFEVDRDFERLGRKILLLNARHMPF
YAGGPRQILLSVSDVTARRLLEGERSELLAQSEAARRDAEAANRSKDEFLATLSHELRTP
LNPIIGFSQLLRRGKCDPAQTAQALEVIERCGKLQAQLIDDMLDISRIISGKLHVVMRRI
DLVPVVGAAVEAVDAIGRAKSIRIETVCAPAPPVMADSTRMQQVVWNLLTNAVKFTPEGG
RVGVRLEGTAAGVRLTVSDTGMGIAPEFLPKMFDRFAQGDGSRTRTQGGLGLGLYLVRSL
IELHGGTVDAHSAGEGRGSVFTVALPAAPPQPEHPDRNLGS
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagattccggggggggagccgattcattctctttgtcgttaggttcttttgcg
atagttgccgtcggggcctcggcaggggggctcgaagctttcacacagtttttgggtgcc
ttgccaaccgataccggcatggcgttcgtgttgatccagcacctcaaagccgaccagccg
agcttgctggttgagatcctggataaaacaaccggcatggacgttgtccaggtgcacaac
ggcacggtcgtggagccaaaccatgtctacgtgatcccgcccgaccggcagatggcgatt
accagcggcgtgctcaccctctcgcagcgccgcaagaccgacgggcagtttatgcccatc
gactccttttttcattcgctggctgcagactggggcaaccgggcgatcggtgtggtgctt
tcgggagcggacggcgacggtgcgcaagggctcaaggcgatcaaggcggcgggcggcctc
gctttcgcccaggacgagcaatcggcccggtttccgagcatgccccacaatgccgcggca
acagggctgctggattttgtcctgccgccccgggagatcgcggtgcggttggccgcggtc
ggccgtcatccctacatcgcccccccggccgccaccgccccgcccaccccgcccggcgcc
gaggaggccaggagtgccgccatcgcgctgctgcgcgccgccaccggggtggacttcggc
cagtacaagcgcccgacctttgagcggcgcttgcaaaggcgcatggcgctgcaccagatc
gaaagcccgcaggaattcgttcgccaccttcaagaccacccggaggaagtccaggccctg
taccgtgacgtgctcatcagcgtcacgggcttttttcgcgaccccgaagctttcgaggcg
gtgaaaaacactgtcctgtccgccattacccagcagcgggccgagggcctgcccatccgc
gtctgggtgccggggtgcgccacgggcgaggaggtctactcccttgccattggcgtgctg
gagttcctggaggagcacccctccccaacccccgtccagtttttcggcactgacatcagc
gaggaggcaatcgcccttgcccgcactggtctctaccacgcctcccaaatcgagggcctc
tcccccgagcggctgcgacggttctttagccagggcgagggcggccaccgggtctgcaag
cgggtgcgcgaactgtgcgtctttgctcgccacgacctgctcgcggatccgcccttttcc
cagatggatctggtcagttgccgcaacgtgttgatttacttctcgctgcctgcccagaag
cgggtgctcactacctttcactacagcctcaagccggacggctttttgctgttgggcacc
tccgagagcccggggggggcgtccgagctgttcaaccgggtcgattcgaaaaacaaactg
ttctcccgaaaggcggtgcccgcccggctgctcctggagtacgccgccgggcccgttgcg
gcggacccgctcaaccccaaacagcccgccgcgggcggggcggggaacgctcccgatctg
caaaaagaggccgaccggctcgttctggaccggtacgccccggtcggcgtggtcgtgggc
gccgacgcggaggtactgcactttcggggccagaccggtccctatctccagccgtcccct
ggccgtgccagcctcaacctgctcaagatggtgcaccccggcttgcgttcacagctgcgc
tcggcgctgcagctggccgccaagcagtcgcttgcccagtgccagcaagatatccggctc
tacgacggcgatcgggagcggcgggtgcgcatcgacgtcgcccccttcagatccgcctcc
gggcagacccactttctggtgttgtttgccgacaccccgatggtcgaggtgagcgcgccg
cttcccggaccccgttccgccgcggccgacaggcaaagcgcccaacagcaaagactcctg
gaattgcagcaggagttgacggccaaggaggaatacctgcgcacggcgattgaggagtcc
gaagccgtcaaccagaacctccgggtcgccaacgaagagatcctctcaagtaacgaagag
ttgcagagcaccaacgaagaactgcagaccgccaaagaagagatccagtccaccaacgaa
gaactccacacgatcaacgacgaactgcagcggcgcaaccgggaactggaccggctcggc
aacgacctgcagaacctgcttgcgagcacccggcttccgatcgtcatgctcgacagcgag
ctgcggattcggcgctttacgccccaggcgggcgaactgctccattttgtctccgccgac
gtcggccggcccgtgcgcgacatcaaccaccggttgagcgtccccgacctgcccgagcgc
gtcctggaggtgatcgccagccggcgcatccacatccaggaggtgcaggaccggggcggc
cactggcacgaactgtgcatccgcccctaccacaccctggatggcgcgaccgagggcgcg
gtgctggtgctggtggacatcgaccagagcaagcgcgccgtcgaggaggtcaaagccgcc
cgcgactacgcagaagcgatcgtcgagaccgtgggcgaaccgctcatcgtgctcgacgca
gaactgagcgcggtgacggcgaaccgggcgttttacgagcttttcgagacccatcccgac
cagatcgagggccgctcactgttcgaggtaagcggcgggcagtggaacctcccccagttg
cgggaggcgctcgaaggggtgctccagggcgacggccgggtgcaggattttgaggtggac
cgcgacttcgagcggctggggcgcaagatcctgctgctcaacgcccgccacatgccgttc
tacgccggtggcccgcgccagatcttgctttcggtttcggatgtcacggcccggagacta
ctggaaggggaacgctccgaattgctcgcccagagcgaggcggcaaggcgggacgccgag
gcggccaaccgctcgaaggacgaatttctggccaccctcagccacgagttgcgcaccccc
ctcaacccgatcatcggcttctcgcaactgctgcggcgcggcaagtgcgacccggcccag
acggcccaggccctggaggtgatcgagcgctgcggcaagctgcaggcgcaactgatcgac
gacatgctcgatatctcgcggatcatctcgggcaaactacacgtcgtgatgcgccgaatc
gatctggtgccggtggtcggtgccgccgtcgaagcggtcgatgcgatcggccgggccaaa
tcgatccgcatcgagacggtgtgcgccccggccccgccggtgatggccgattccacccgg
atgcagcaggtggtgtggaacctgctcaccaacgccgtcaaattcacccccgaaggcggg
cgggtgggggtgcggctggagggtaccgccgcgggcgtgcgcctgacggtgtccgacacg
ggtatgggcatcgcgccggagttcttaccgaaaatgttcgatcgcttcgcccagggagac
ggctcccgcacccgcacccagggcggactgggattgggcctgtatctggtgcgcagcctg
atcgaactgcacggcggcaccgtcgacgcccacagcgcgggagaaggccggggcagtgtc
ttcaccgtcgcattgcccgccgctccgccgcagcctgaacacccggatcggaacctcggg
tcttga

DBGET integrated database retrieval system