KEGG   Gloeobacter violaceus: gll2315Help
Entry
gll2315           CDS       T00148                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gvi  Gloeobacter violaceus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    gll2315
Enzymes [BR:gvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     gll2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(2479489..2480397)
Genome map
AA seq 302 aa AA seqDB search
MGSAKVVVAGSINMDIVVRAARHPQPGETLLGQSVQFFAGGKGANQAIAAYRLGTPVILI
ARVGDDGFGGSLRAFVSQEGLDTQRVLATAGASGTALITVADSGENTIVVVPGANDALSP
VDVEVDIEPGDVLVSQCEIPAQTIEHFFVRGKRLGARTLLNAAPARPLAPTLAAAADVLV
VNESELAILTGAAVDAEDAGTVIAAARSLQPAIENVVVTLGGRGAVACLGPVSETVPGRR
VEVVVDTTGAGDGFVGALAARLAAGEPFAQALVFANAAASICVERPGAAASMPTMAEVLA
VL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgcgaaggtggtcgtagccggcagcatcaacatggacatcgtcgtgcgcgcc
gcgcgtcatccacagccgggcgaaacgctcctgggccaatcggtgcagtttttcgcgggc
ggcaaaggcgccaatcaggcaatcgcggcctaccgtctggggacgccggtcatattgatc
gcccgggtgggagacgacggtttcggtggaagtctgcgcgccttcgtaagccaggaaggc
ctggatacgcaacgggtactggcgacggcaggagcgagcggcacggcgctcatcaccgta
gccgatagcggtgagaacacaatcgtcgtcgttcccggcgccaacgacgcgctgagcccg
gtggatgtcgaagtggatatcgagccgggcgatgtgctggtgagccagtgcgagatcccc
gcccagacgatcgaacatttttttgtccggggaaaacggctgggggcgcgcacgcttctc
aacgccgcccctgcccggcctttagccccgaccctggcggcggcggcggatgttctggtt
gtcaacgagagtgaactggccatcctcactggtgcggctgtcgatgccgaggatgccggg
acggtgatcgccgccgcccgttcgttgcaacctgcaatcgaaaatgtcgtggtcaccctc
ggcgggcggggagcggtggcctgcctcgggccggtgagcgagacggtaccggggcggcgg
gtggaagtcgtggtcgataccaccggggcgggggacggcttcgtgggtgcgttggcggcc
cggctggccgccggtgagccttttgcacaggcactcgtcttcgccaacgccgccgcttcg
atctgcgtggagcggcccggggccgccgcctcgatgccgaccatggccgaggtgctggcg
gtgttgtag

DBGET integrated database retrieval system