KEGG   Gloeobacter violaceus: gll2460Help
Entry
gll2460           CDS       T00148                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
gvi  Gloeobacter violaceus
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gvi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
Position
complement(2617867..2620470)
Genome map
AA seq 867 aa AA seqDB search
MLSMGAYSRRNFLRSALLAASLPLALPRSGRSAPAGTTATLAALRAEVPKAGWTYPIGQP
IADAFKVRYPSNIDDGYWHGMPLGGFGAGCIGRSHRGDFTLWHLDSGDHYFRSQPVCQFA
LFEQSEGAKPRAKVLCTEKPADGSLGAWDWTYPKGAGTYAALYPRSWFTYEGFFNSHVQL
KQFSPIIPNNYKQTSYPVAVFEWTAFNPTDQPVTLSILVSWENMVGWFTNQFKSRAVKVR
DDDTPVYDYEPYWGESTGNFNSAREENAYRGLTMSRASGYTEQQKPAPATAAVSERPFVT
AEGDGQFVIATTREPDVEITYHTRFDPTGNGLEVWQPFATTGRLGDLVSVRPAAKGERIA
AAMAVRLTLKPGELRVVPMALAWDLPIMEFAQGVRRYRYYTKHFDKSGRNAWKIATEALD
NYADWDRQIQEWQNPVLADPSLPDWYKQALFNELYYLTSGGTLWENGPVPEKITSLADIA
KAPPGQGRFAVLESIDYRWYDSLDVRLYGSFALLINWPEIDKAVLRSYADAVPDEDDSTR
IIGYTKTVAKRKSRDALPHDLGAPNEDPWIKNNYTTYQDCNLWKDLPCDFVLQVYRDYVD
TGKRDLGFVRYCWPASKAALVRLKTTFDQDGDGFPENGGPPDCTYDAWPLKGISAYCGGL
WLAALLAAVEMGKLVGDAAAVQQFGAWYAQAQPLYEKTLWNGRYYRIDSQSKNSEAIMAD
QLCGEYYAQVCNLADIVPEPQARSALETVYQTCFVKFYGGRFGCANGTNADGSFIGDTEH
PSEVWTGINFGLAAFMIRNGMRREGMAIAEAVVANVYGGGLQFRTPEALTPARTFRACMY
LRPMAIWAMQHSLSALKSSKSPTAGKV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtccatgggtgcttactcccgccgaaattttttgcgctccgccttgcttgccgcc
tcgctgcccctggcccttccccgctccggccgctccgctccggccggtacgaccgccacc
ctcgccgctttgcgcgccgaggtgcccaaagccggctggacctatcccatcggccagccg
attgcggatgccttcaaggtgcgctacccgagcaacatcgacgacggctactggcacggc
atgcccctgggggggttcggtgcgggctgcatcggccgctcgcaccggggggactttacc
ctctggcacctcgatagcggcgatcactactttcgctcccagccggtctgccagtttgcc
ctctttgagcagagcgaaggggccaaaccgcgcgcaaaggtgctttgtaccgaaaaaccc
gcagacggcagcctgggcgcctgggactggacctatcccaaaggggcgggcacctacgcg
gccctctatccgcgctcgtggttcacctacgaaggctttttcaacagccacgtgcaactg
aagcagttctcgcccatcatccccaacaactacaagcagaccagttacccggtggccgtc
ttcgagtggaccgccttcaacccgaccgaccaacccgtcacgctgagcattctggtcagt
tgggaaaacatggtgggctggttcaccaaccaattcaaatccagagcagtcaaagtgcgc
gacgacgatacgcccgtctacgattacgaaccgtactggggcgagagcaccggcaacttt
aattcggcgcgtgaggagaacgcctaccggggactgacgatgagccgcgcctcgggctac
accgaacagcaaaagcccgccccggccaccgccgccgtcagcgagcgtcccttcgtcact
gccgaaggggacggccagttcgtgatcgccaccacccgcgagccggacgtcgaaatcact
taccacacccgcttcgatccgaccggcaacggcctggaggtctggcagcccttcgccacc
accggccgcctcggcgatctggtctcggtccggccggcggccaagggcgagcggatcgcg
gcggcgatggcggtgcgcttgaccctcaagcccggcgagctcagggtggtgccgatggcc
ctcgcctgggatttgccgatcatggaattcgcccagggggtgcgccgctaccgctactac
accaagcacttcgacaagagcggccgcaacgcctggaagatcgccaccgaggctctggat
aattacgccgactgggaccggcagatccaggagtggcaaaacccggtccttgccgatccg
agcctgccggactggtacaagcaggcgctctttaacgagctgtactatctcaccagcggc
ggcaccctctgggagaacggcccggttcctgaaaaaatcacttccctcgccgatatcgcc
aaagcgccccccggccagggccgcttcgcagtcctcgaatcgatcgactaccgctggtac
gactcgctcgatgtcaggctttacgggtcgtttgcgctgctgatcaactggcctgaaatc
gacaaagcggtgctcaggtcctacgccgacgccgtgcccgacgaggacgattcgacgcgc
attatcggctacaccaaaaccgtcgccaagcgcaaatcccgcgacgcgctgccccacgac
ctgggggctcccaacgaagatccgtggatcaagaacaactacaccacctaccaggactgc
aacctctggaaggacctgccctgcgacttcgtgctgcaggtctaccgcgactacgtcgat
accggcaaacgcgatctgggttttgtgcgctactgctggcccgcgtccaaggcggccctg
gtgcgcctcaagacgacttttgaccaggatggggacgggtttcccgaaaacggcggcccg
ccggactgcacctacgacgcctggcccctcaaggggatcagcgcctactgcggcgggctg
tggcttgccgcattgcttgccgccgtcgagatgggcaagctcgtgggcgacgcggcggcg
gttcagcagttcggcgcctggtatgcccaggcccagcctctgtacgaaaagaccctctgg
aacggccgctactaccgcatcgacagccagagcaaaaattccgaagcgatcatggccgat
cagttgtgcggcgaatattatgcccaggtgtgcaatctcgcggacatcgtaccggagccc
caggcgcgctcggcgctcgaaacggtttaccaaacctgttttgtaaaattttatggcggg
cgcttcggctgcgccaacggcaccaacgccgacggatcttttatcggcgacaccgagcac
ccctcggaagtctggaccggcatcaactttggcctcgccgcctttatgatccgcaacggc
atgcggcgcgaagggatggccatcgccgaggcggttgtcgccaatgtctacgggggcggg
ttgcagtttcgcacccccgaagcgctcaccccggcgcgcacctttcgcgcctgtatgtac
ctgaggccgatggccatctgggcgatgcaacacagcttgagcgccctcaaaagcagcaaa
tcccccacggcgggcaaggtctga

DBGET integrated database retrieval system